| Catalog No. | Size | Price (USD) |
| rp144254-10μg | 10μg | $159.90 |
| rp144254-50μg | 50μg | $479.90 |
| rp144254-100μg | 100μg | $767.90 |
| rp144254-1mg | 1mg | $4,939.90 |
Product Information
| Product Name | Recombinant Human CEACAM-3/CD66d Protein |
| Short Description | Animal Free, ≥95% (SDS-PAGE), Active, E.coli, C-His tag, 35-155 aa |
| Species | Human |
| Expressed Host | E. coli |
| Accession | P40198 |
| Amino Acids | 35-155 aa |
| Protein TAG | C-His |
| Form | Lyophilized |
| Purity | ≥95% (SDS-PAGE) |
| Specifications & Purity | Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,His-Tag,≥95%(SDS-PAGE) |
| Endotoxin Concentration | <1.0 EU/μg |
| Biological Activity | When Recombinant Human CEACAM‑3/CD66d is immobilized at 2 µg/mL (100 µL/well), the concentration of Recombinant Human CEACAM-7 that produces 50% of the optimal binding response is 0.6-3.6 μg/mL. |
| SDS Page | 15 - 20 kDa, under reducing conditions; 15 - 20 kDa, under non-reducing conditions. |
| Sequence | MKLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAGHHHHHH |
| Synonyms | Carcinoembryonic antigen CGM1 | carcinoembryonic | Carcinoembryonic antigen CGM1 | Carcinoembryonic antigen gene family member 1 | carcinoembryonic antigen related cell adhesion molecule 3 | Carcinoembryonic antigen-related cell adhesion molecule 3 | cd66 |
Product Description
Purity
≥95% (SDS-PAGE)
Endotoxin level
<1.0 EU/μg
Function
Major granulocyte receptor mediating recognition and efficient opsonin-independent phagocytosis of CEACAM-binding microorganisms, including Neissiria, Moxarella and Haemophilus species, thus playing an important role in the clearance of pathogens by the innate immune system. Responsible for RAC1 stimulation in the course of pathogen phagocytosis.
Reconstitution
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20~-80℃ for more than 1 year. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
