Recombinant Human Delta-like protein 3 (DLL3), partial (Active) CSB-MP882142HU3 CUSABIO
$138.00
In stock
SKU
CSB-MP882142HU3
Product Details
| Uniprot No. | Q9NYJ7 |
| Alternative Names | Delta-like protein 3; Drosophila Delta homolog 3 (Delta3) |
| Species | Homo sapiens (Human) |
| Source | Mammalian cell |
| Expression Region | 391-492aa |
| Purity | Greater than 95% as determined by SDS-PAGE. Greater than 90% as determined by SEC-HPLC. |
| Activity | Measured by its binding ability in a functional ELISA. Immobilized Human DLL3 at 1 μg/mL can bind Anti-DLL3 recombinant antibody (CSB-RA882142MA2HU). The EC50 is 6.080-7.240 ng/mL. |
| Tag Info | C-terminal mFc-tagged |
| Form | Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs | Protein FAQs |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Lead Time | 3-7 business days |
| Target Names | DLL3 |
| Target Protein Sequence | DLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL |
| Mol. Weight | 39.7 kDa |
| Protein Length | Partial |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Datasheet & COA | Please contact us to get it. |
| Description | The gene fragment encoding the 391-492aa of the human DLL3 is co-expressed with the C-terminal mFc-tag gene in mammalian cells. The resulting product is the recombinant human DLL3 protein. This DLL3 protein is active as it can bind to the DLL3 recombinant antibody (CSB-RA882142MA2HU), with the EC50 of 6.080-7.240 ng/mL. Its purity is up to 95% as determined by SDS-PAGE. The human DLL3 protein is a multifunctional protein that regulates Notch signaling, cell proliferation, migration, and invasion, with particular relevance in the context of neuroendocrine tumors. Its unique expression profile and role in tumor biology make it a potential therapeutic target in certain cancer types. RDLL3 is an atypical Notch ligand that can inhibit Notch receptor activation [1-3]. This inhibition of Notch signaling promotes neuroendocrine differentiation [2]. DLL3 overexpression has been shown to promote tumor growth and inhibit apoptosis in various cancer types, including small cell lung cancer (SCLC) and hepatocellular carcinoma [4][5]. However, some studies have also reported that DLL3 can induce cellular apoptosis in hepatocellular carcinoma [6]. DLL3 has been found to modulate the epithelial-mesenchymal transition (EMT) process, thereby affecting the migration and invasion of cancer cells, such as in SCLC [5][6]. DLL3 is expressed in the presomitic mesoderm during embryonic development and plays a role in somite patterning and axial skeleton development [11][12]. DLL3 is highly expressed in neuroendocrine tumors, including SCLC, and is a downstream target of the transcription factor ASCL1, which is related to the neuroendocrine phenotype [1][4][7]. Due to its specific expression on the surface of neuroendocrine tumor cells, DLL3 has emerged as a promising target for antibody-drug conjugate (ADC) therapies, particularly in SCLC and other high-grade neuroendocrine tumors [8-10]. References: [1] D. Morgensztern, B. Besse, L. Greillier, R. Santana-Dávila, N. Ready, C. Hann, et al. Efficacy and safety of rovalpituzumab tesirine in third-line and beyond patients with dll3-expressing, relapsed/refractory small-cell lung cancer: results from the phase ii trinity study, Clinical Cancer Research, vol. 25, no. 23, p. 6958-6966, 2019. https://doi.org/10.1158/1078-0432.ccr-19-1133 [2] S. Tendler, L. Kanter, R. Lewensohn, C. Ortiz-Villalón, K. Viktorsson, & L. Petris. The prognostic implications of notch1, hes1, ascl1, and dll3 protein expression in sclc patients receiving platinum-based chemotherapy, Plos One, vol. 15, no. 10, p. e0240973, 2020. https://doi.org/10.1371/journal.pone.0240973 [3] K. Matsuo, K. Taniguchi, H. Hamamoto, Y. Inomata, K. Komura, T. Tanaka, et al. Delta‐like canonical notch ligand 3 as a potential therapeutic target in malignancies: a brief overview, Cancer Science, vol. 112, no. 8, p. 2984-2992, 2021. https://doi.org/10.1111/cas.15017 [4] C. Zhu. The predictive value of delta-like3 and serum nse in evaluating chemotherapy response and prognosis in patients with advanced small cell lung carcinoma: an observational study, Medicine, vol. 103, no. 23, p. e38487, 2024. https://doi.org/10.1097/md.0000000000038487 [5] M. Furuta, H. Kikuchi, T. Shoji, Y. Takashima, E. Kikuchi, J. Kikuchi, et al. dll3 regulates the migration and invasion of small cell lung cancer by modulating snail, Cancer Science, vol. 110, no. 5, p. 1599-1608, 2019. https://doi.org/10.1111/cas.13997 [6] L. Yang, G. Wang, H. Shi, S. Jia, J. Ruan, R. Cui, et al. Methylation-driven gene dll3 is a potential prognostic biomarker in ocular melanoma correlating with metastasis, Frontiers in Oncology, vol. 12, 2022. https://doi.org/10.3389/fonc.2022.964902 [7] M. Furuta, J. Sakakibara‐Konishi, H. Kikuchi, H. Yokouchi, H. Nishihara, H. Minemura, et al. Analysis of dll3 and ascl1 in surgically resected small cell lung cancer (hot1702), The Oncologist, vol. 24, no. 11, p. e1172-e1179, 2019. https://doi.org/10.1634/theoncologist.2018-0676 [8] K. Krytska, C. Casey, J. Pogoriler, D. Martı́nez, K. Rathi, A. Farrel, et al. Evaluation of the dll3-targeting antibody–drug conjugate rovalpituzumab tesirine in preclinical models of neuroblastoma, Cancer Research Communications, vol. 2, no. 7, p. 616-623, 2022. https://doi.org/10.1158/2767-9764.crc-22-0137 [9] L. Saunders, A. Bankovich, W. Anderson, M. Aujay, S. Bheddah, K. Black, et al. A dll3-targeted antibody-drug conjugate eradicates high-grade pulmonary neuroendocrine tumor-initiating cells in vivo, Science Translational Medicine, vol. 7, no. 302, 2015. https://doi.org/10.1126/scitranslmed.aac9459 [10] L. Brčić, C. Kuchler, S. Eidenhammer, D. Pabst, F. Quehenberger, A. Gazdar, et al. Comparison of four dll3 antibodies performance in high grade neuroendocrine lung tumor samples and cell cultures, Diagnostic Pathology, vol. 14, no. 1, 2019. https://doi.org/10.1186/s13000-019-0827-z [11] I. Geffers, K. Serth, G. Chapman, R. Jaekel, K. Schuster-Gossler, R. Cordes, et al. Divergent functions and distinct localization of the notch ligands dll1 and dll3 in vivo, The Journal of Cell Biology, vol. 178, no. 3, p. 465-476, 2007. https://doi.org/10.1083/jcb.200702009 [12] P. Turnpenny, N. Whittock, J. Duncan, S. Dunwoodie, K. Kusumi, & S. Ellard. Novel mutations in dll3, a somitogenesis gene encoding a ligand for the notch signalling pathway, cause a consistent pattern of abnormal vertebral segmentation in spondylocostal dysostosis, Journal of Medical Genetics, vol. 40, no. 5, p. 333-339, 2003. https://doi.org/10.1136/jmg.40.5.333 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
