Recombinant Human Muscarinic acetylcholine receptor M3 (CHRM3), partial CSB-EP005383HU CUSABIO
$224.00
In stock
SKU
CSB-EP005383HU
Product Details
| Uniprot No. | P20309 |
| Alternative Names | AChR; ACM3_HUMAN; cholinergic receptor muscarinic 3; CHRM 3; CHRM3; EGBRS; HM 3; HM3; m3 muscarinic acetylcholine receptor; M3 muscarinic receptor; muscarinic 3; Muscarinic acetylcholine receptor M3; muscarinic cholinergic m3 receptor; muscarinic m3 receptor |
| Species | Homo sapiens (Human) |
| Source | E.coli |
| Expression Region | 253-492aa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Tag Info | N-terminal 6xHis-B2M-tagged |
| Form | Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | Tris-based buffer,50% glycerol |
| Troubleshooting and FAQs | Protein FAQs |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Lead Time | 3-7 business days |
| Target Names | CHRM3 |
| Research Area | others |
| Target Protein Sequence | RIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSMKRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKRMSLVKEKKAAQT Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc. If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering. |
| Mol. Weight | 40.7kDa |
| Protein Length | Partial |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Datasheet & COA | Please contact us to get it. |
| Description | This recombinant human muscarinic acetylcholine receptor M3 (CHRM3) features a purity greater than 90%, as measured by SDS-PAGE. It is expressed from the expression vector carrying the gene encoding the 253-492aa of human CHRM3 and the N-terminal 6xHis-B2M-tag gene in E. coli. It is available in both liquid and lyophilized forms. The human CHRM3 is involved in several critical biological processes, including glandular secretion, smooth muscle contraction, and modulation of insulin secretion from pancreatic islets [1][2]. It is predominantly expressed in tissues such as the brain, lungs, and gastrointestinal tract, where it contributes to regulating autonomic functions and influences processes like inflammation and cell proliferation. In the pancreas, CHRM3 is crucial in enhancing glucose-induced insulin secretion. Studies have demonstrated that stimulation of the CHRM3 leads to increased insulin release, which is essential for maintaining glucose homeostasis [1][3]. CHRM3's activation is mediated through phosphorylation processes that enhance its signaling capabilities, particularly in response to agonists like acetylcholine and pilocarpine [4][5]. Dysregulation of CHRM3 has been implicated in various pathophysiological conditions, including asthma, obesity, and certain neurodegenerative diseases. The activation of CHRM3 can promote tumor cell proliferation and migration, particularly in small-cell lung carcinoma and gastric cancer [6][7]. The CHRM3 signaling involves various intracellular pathways, including the activation of protein kinase D1 and the mitogen-activated protein kinase (MAPK) pathway, which are crucial for mediating the effects of M3 receptor activation on cell proliferation and insulin secretion [1][3][8]. References: [1] K. Kong, A. Butcher, P. McWilliams, D. Jones, J. Wess, F. Hamdanet al., M3-muscarinic receptor promotes insulin release via receptor phosphorylation/arrestin-dependent activation of protein kinase d1, Proceedings of the National Academy of Sciences, vol. 107, no. 49, p. 21181-21186, 2010. https://doi.org/10.1073/pnas.1011651107 [2] T. Renuka, R. Robinson, & C. Paulose, Increased insulin secretion by muscarinic m1 and m3 receptor function from rat pancreatic islets in vitro, Neurochemical Research, vol. 31, no. 3, p. 313-320, 2006. https://doi.org/10.1007/s11064-005-9022-6 [3] A. Duttaroy, C. Zimliki, D. Gautam, Y. Cui, D. Mears, & J. Wess, Muscarinic stimulation of pancreatic insulin and glucagon release is abolished in m3 muscarinic acetylcholine receptor–deficient mice, Diabetes, vol. 53, no. 7, p. 1714-1720, 2004. https://doi.org/10.2337/diabetes.53.7.1714 [4] A. Butcher, R. Prihandoko, K. Kong, P. McWilliams, J. Edwards, A. Bottrillet al., Differential g-protein-coupled receptor phosphorylation provides evidence for a signaling bar code, Journal of Biological Chemistry, vol. 286, no. 13, p. 11506-11518, 2011. https://doi.org/10.1074/jbc.m110.154526 [5] I. Torrecilla, E. Spragg, B. Poulin, P. McWilliams, S. Mistry, A. Blaukatet al., Phosphorylation and regulation of a g protein–coupled receptor by protein kinase ck2, The Journal of Cell Biology, vol. 177, no. 1, p. 127-137, 2007. https://doi.org/10.1083/jcb.200610018 [6] P. Song, H. Sekhon, A. Lu, J. Arredondo, D. Sauer, C. Gravettet al., M3 muscarinic receptor antagonists inhibit small cell lung carcinoma growth and mitogen-activated protein kinase phosphorylation induced by acetylcholine secretion, Cancer Research, vol. 67, no. 8, p. 3936-3944, 2007. https://doi.org/10.1158/0008-5472.can-06-2484 [7] L. Wang, J. Xu, Y. Xia, K. Yin, Z. Li, B. Liet al., Muscarinic acetylcholine receptor 3 mediates vagus nerve-induced gastric cancer, Oncogenesis, vol. 7, no. 11, 2018. https://doi.org/10.1038/s41389-018-0099-6 [8] T. Takahashi, A. Shiraishi, J. Murata, S. Matsubara, S. Nakaoka, S. Kirimotoet al., Muscarinic receptor m3 contributes to intestinal stem cell maintenance via ephb/ephrin-b signaling, Life Science Alliance, vol. 4, no. 9, p. e202000962, 2021. https://doi.org/10.26508/lsa.202000962 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
