Recombinant Mouse GDNF family receptor alpha-like (Gfral), partial (Active) CSB-MP750964MO1 CUSABIO
$9.90
In stock
SKU
CSB-MP750964MO1
Product Details
| Uniprot No. | Q6SJE0 |
| Species | Mus musculus (Mouse) |
| Source | Mammalian cell |
| Expression Region | 20-349aa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
| Activity | Measured by its binding ability in a functional ELISA. Immobilized Mouse Gfral at 5 μg/mL can bind Mouse Gdf15 (CSB-MP859530MO), the EC 50 is 7.926-10.52 ng/mL. |
| Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Form | Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs | Protein FAQs |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Lead Time | 3-7 business days |
| Target Names | Gfral |
| Research Area | Cell Biology |
| Target Protein Sequence | QTNDCAHLIQKCLIDANGCEQSWRSMEDTCLTPGDSCKINNSLHCNLSIQALVEKNFQFKECLCMDDLHCTVNKLFGKKCTNKTDNMEKDNKDKWNLTTTPFYHGFKQMQSCLEVTEACVGDVVCNAQLALYLKACSANGNLCDVKHCQAAIRFFYQNMPFNTAQMLAFCDCAQSDIPCQQSKETLHSKPCALNIVPPPTCLSVIHTCRNDELCRTHYRTFQTECWPHITGKCHEDETCISMLGKQDLTCSGSESCRAAFLGTFGTVLQVPCACRGVTQAEEHVCMIFQHMLHSKSCFNYPTPNVKDISSYEKKNSKEITLTGFNSFFNG |
| Mol. Weight | 42.1 kDa |
| Protein Length | Partial |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Datasheet & COA | Please contact us to get it. |
| Description | GFRAL serves as the exclusive receptor for GDF15, a stress-response cytokine implicated in metabolic regulation and body weight homeostasis, making precise characterization of this interaction essential for metabolic drug discovery. This recombinant mouse GFRAL fragment (residues 20–349) encompasses the extracellular ligand-binding domain and is expressed in mammalian cells to preserve the native glycosylation and disulfide bonding critical for conformational integrity. Functional ELISA confirms robust ligand engagement, with immobilized GFRAL (5 µg/mL) binding mouse GDF15 at an EC50 of 7.926–10.52 ng/mL, providing a suitable basis for receptor-ligand interaction assays, competitive inhibition studies, blocking antibody screening, and small-molecule inhibitor discovery campaigns. Purity exceeds 95% by SDS-PAGE and endotoxin levels remain below 1.0 EU/µg, which satisfies the quality thresholds commonly required for SPR- or BLI-based affinity characterization, epitope mapping, and use as a positive control in quantitative binding assays. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
