FcZero-rAb® APC Anti-Human C5AR1/CD88 Rabbit Recombinant Antibody APC-FcA98226 proteintech
$236.00
In stock
SKU
APC-FcA98226
| Catalog Number | APC-FcA98226 |
| Synonyms | C5AR, C5AR1, C5A, C5a anaphylatoxin chemotactic receptor 1, C5a R |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, BSA |
| Applications | FC |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive FC detected in | human peripheral blood leukocytes |
| Positive FC detected in | human peripheral blood leukocytes |
| Flow Cytometry (FC) | FC : 5 ul per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg2185 Product name: Recombinant Human C5AR1/CD88 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 1-37 aa of NM_001736.4 Sequence: MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPD Predict reactive species |
| Full Name | complement component 5a receptor 1 |
| Calculated Molecular Weight | 39kDa |
| GenBank Accession Number | NM_001736.4 |
| Gene Symbol | C5aR |
| Gene ID (NCBI) | 728 |
| RRID | AB_3746599 |
| Conjugate | APC Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 650 nm / 660 nm |
| Excitation Laser | Red Laser (633 nm) |
| Purification Method | Protein A purification |
| UNIPROT ID | P21730 |
| Storage Buffer | PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. |
| FC protocol for APC C5AR1/CD88 antibody APC-FcA98226 | Download protocol |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 241712D4 |
| Conjugation | APC |
C5aR, also named CD88, is a G protein-coupled receptor for the anaphylatoxin C5a, a cleavage product of the complement cascade. The C5a ligand is a proinflammatory component of host defense. C5aR is activated upon binding of the C5a molecule. Receptor activation stimulates chemotaxis, granule enzyme release, intracellular calcium release, and superoxide anion production. Protocols Product Specific Protocols FC protocol for APC C5AR1/CD88 antibody APC-FcA98226 Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review