DDX3 Polyclonal antibody 11115-1-AP proteintech
$149.00
In stock
SKU
11115-1-AP
| Catalog Number | 11115-1-AP |
| Synonyms | DDX3X, ATP-dependent RNA helicase DDX3X, CAP-Rf, DBX, DDX14 |
| Host | Rabbit |
| Reactivity | human, mouse, rat and More (1) |
| Reactivity | human, mouse, rat, chicken |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, RIP, ELISA |
| Applications | WB, IHC, IF/ICC, FC (Intra), IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, HepG2 cells, mouse brain tissue, mouse liver tissue, K-562 cells, C6 cells, PC-12 cells, rat brain tissue |
| Tested Applications — Positive IP detected in | HeLa cells |
| Tested Applications — Positive IHC detected in | human malignant melanoma tissue, human cervical cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HepG2 cells |
| Tested Applications — Positive FC (Intra) detected in | HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:8000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Recommended Dilutions — Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Positive WB detected in | HeLa cells, HepG2 cells, mouse brain tissue, mouse liver tissue, K-562 cells, C6 cells, PC-12 cells, rat brain tissue |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human malignant melanoma tissue, human cervical cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HeLa cells |
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, chicken |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag1614 Product name: Recombinant human DDX3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 312-662 aa of BC011819 Sequence: DLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAYEHHYKGSSRGRSKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGGGHGSSRGFGGGGYGGFYNSDGYGGNYNSQGVDWWGN Predict reactive species |
| Full Name | DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, X-linked |
| Calculated Molecular Weight | 73 kDa |
| Observed Molecular Weight | 73 kDa |
| GenBank Accession Number | BC011819 |
| Gene Symbol | DDX3 |
| Gene ID (NCBI) | 1654 |
| RRID | AB_10896499 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O00571 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| FC protocol for DDX3 antibody 11115-1-AP | Download protocol |
| IF protocol for DDX3 antibody 11115-1-AP | Download protocol |
| IHC protocol for DDX3 antibody 11115-1-AP | Download protocol |
| IP protocol for DDX3 antibody 11115-1-AP | Download protocol |
| WB protocol for DDX3 antibody 11115-1-AP | Download protocol |
| human | WB Pharmacol Res HPV E7-drived ALKBH5 promotes cervical cancer progression by modulating m6A modification of PAK5 Authors - Fu-Chun Huo KD Validated View Article |
| mouse | WB,IF,CoIP Ecotoxicol Environ Saf Aluminum exposure induces central nervous system impairment via activating NLRP3-medicated pyroptosis pathway Authors - Wudi Hao View Article |
| Shannon (Verified Customer) (07-19-2022) | Worked well, also binds to different isoforms/protein dimers Applications: Western Blot, Immunoprecipitation Primary Antibody Dilution: 1:2000 Cell Tissue Type: Jurkat T-Cells DDX3 Antibody Western Blot,Immunoprecipitation validation (1:2000 dilution) in Jurkat T-Cells (Cat no:11115-1-AP) |
| Citations | 47 |
| Dilutions | WB : 1:1000-1:8000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:50-1:500 IF/ICC : 1:200-1:800 FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
DDX3X, also named as DBX, DDX3 and HLP2, belongs to the DEAD box helicase family and DDX3/DED1 subfamily. It is ATP-dependent RNA helicase. DDX3X acts as a cofactor for XPO1-mediated nuclear export of incompletely spliced HIV-1 Rev RNAs. It is also involved in HIV-1 replication. DDX3X interacts specifically with hepatitis C virus core protein resulting in a change in intracellular location. 73 kDa is the target band. 60-65 kDa is some other isoform. This antibody can bind both DDX3X and DDX3Y for the close sequences. Protocols Product Specific Protocols FC protocol for DDX3 antibody 11115-1-AP Download protocol IF protocol for DDX3 antibody 11115-1-AP Download protocol IHC protocol for DDX3 antibody 11115-1-AP Download protocol IP protocol for DDX3 antibody 11115-1-AP Download protocol WB protocol for DDX3 antibody 11115-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Diverse CMT2 neuropathies are linked to aberrant G3BP interactions in stress granules
Journal: Cell | Authors: Qinqin Cui | Species: human | Application: WB,CoIP - Pathogenic DDX3X Mutations Impair RNA Metabolism and Neurogenesis during Fetal Cortical Development.
Journal: Neuron | Authors: Ashley L Lennox | Application: IF - CRISPR-Cas9 Screens Identify the RNA Helicase DDX3X as a Repressor of C9ORF72 (GGGGCC)n Repeat-Associated Non-AUG Translation.
Journal: Neuron | Authors: Weiwei Cheng KD Validated | Species: human | Application: WB - NR4A1 depletion inhibits colorectal cancer progression by promoting necroptosis via the RIG-I-like receptor pathway
Journal: Cancer Lett | Authors: Jinghan Zhu | Species: human | Application: WB - HPV E7-drived ALKBH5 promotes cervical cancer progression by modulating m6A modification of PAK5
Journal: Pharmacol Res | Authors: Fu-Chun Huo KD Validated | Species: human | Application: WB - Aluminum exposure induces central nervous system impairment via activating NLRP3-medicated pyroptosis pathway
Journal: Ecotoxicol Environ Saf | Authors: Wudi Hao | Species: mouse | Application: WB,IF,CoIP - AEP-cleaved DDX3X induces alternative RNA splicing events to mediate cancer cell adaptation in harsh microenvironments
Journal: J Clin Invest | Authors: Wenrui Zhang | Species: human | Application: WB - Ascites circRNA ASCOR Drives Platinum Resistance of High-Grade Serous Ovarian Cancer by Facilitating RPA1 Nuclear Translocation.
Journal: Adv Sci (Weinh) | Authors: Hanyuan Liu | Species: human | Application: WB - HPV E7-drived ALKBH5 promotes cervical cancer progression by modulating m6A modification of PAK5
Journal: Pharmacol Res | Authors: Fu-Chun Huo | Species: human | Application: WB - TM4SF1-AS1 inhibits apoptosis by promoting stress granule formation in cancer cells
Journal: Cell Death Dis | Authors: Hiroshi Kitajima | Application: RIP - Targeting FAM134B-DDX3X axis inhibiting AKT signaling in hepatocellular carcinoma
Journal: Cell Death Dis | Authors: Jie Mo | Species: human | Application: WB,IP,IF - Sex-linked helicases DDX3X and DDX3Y regulate G-quadruplex-associated stress in neurons.
Journal: Cell Death Dis | Authors: Rocio Diaz Escarcega - Sex-linked helicases DDX3X and DDX3Y regulate G-quadruplex-associated stress in neurons.
Journal: Cell Death Dis | Authors: Rocio Diaz Escarcega - Inhibition of DDX3 modulates immune signaling in aggressive breast cancers
Journal: Cancer Lett | Authors: Farhad Vesuna - NR4A1 depletion inhibits colorectal cancer progression by promoting necroptosis via the RIG-I-like receptor pathway
Journal: Cancer Lett | Authors: Jinghan Zhu | Species: human | Application: WB - DDX3 acts as a tumor suppressor in colorectal cancer as loss of DDX3 in advanced cancer promotes tumor progression by activating the MAPK pathway.
Journal: Int J Biol Sci | Authors: Lin Shen | Species: human | Application: WB,IHC - In vitro and in vivo inhibition of the host TRPC4 channel attenuates Zika virus infection
Journal: EMBO Mol Med | Authors: Xingjuan Chen | Application: WB,IF - The divergent effects of G3BP orthologs on human stress granule assembly imply a centric role for the core protein interaction network
Journal: Cell Rep | Authors: Zhiying Yao - The divergent effects of G3BP orthologs on human stress granule assembly imply a centric role for the core protein interaction network
Journal: Cell Rep | Authors: Zhiying Yao - The proteome and transcriptome of stress granules and P bodies during human T lymphocyte activation
Journal: Cell Rep | Authors: Nicolas Curdy | Species: mouse | Application: WB - Aluminum exposure induces central nervous system impairment via activating NLRP3-medicated pyroptosis pathway
Journal: Ecotoxicol Environ Saf | Authors: Wudi Hao | Species: mouse | Application: WB,IF,CoIP - MANF inhibits NLRP3 inflammasome activation by competitively binding to DDX3X in paraquat-stimulated alveolar macrophages
Journal: Ecotoxicol Environ Saf | Authors: Yi Pu | Species: mouse | Application: IF,CoIP - A novel stroke rehabilitation strategy and underlying stress granule regulations through inhibition of NLRP3 inflammasome activation
Journal: CNS Neurosci Ther | Authors: Qingzhu Wang | Species: rat | Application: WB,CoIP - HMGB1 downregulates DDX3 to activate the MAPK pathway, promoting the progression of colorectal cancer
Journal: Cancer Gene Ther | Authors: Lin Ma - E3 ubiquitin ligase trim36 targets ddx3x for degradation to reprogram macrophage polarization and ameliorate tubal factor infertility in rats.
Journal: Cell Biol Toxicol | Authors: Liang Shao | Species: rat | Application: WB,IF,CoIP - (DEAD)-box RNA helicase 3 modulates NF-κB signal pathway by controlling the phosphorylation of PP2A-C subunit.
Journal: Oncotarget | Authors: Xin Wang | Species: human | Application: WB,IF - Avian leukosis virus subgroup J evades innate immunity by activating miR-155 to dually target TRAF3 and STAT1.
Journal: PLoS Pathog | Authors: Xinyue Zhang | Species: chicken | Application: WB - lncRNA NKILA Promotes Warburg Effect and Immune Escape in Intrahepatic Cholangiocarcinoma by Regulating the MTX1/TOMM40 Axis.
Journal: Mediators Inflamm | Authors: Meiying Zhu | Species: human | Application: RIP - miR-135a-5p alleviates cerebral ischemia-reperfusion injury by inhibiting pyroptosis mediated through the DDX3X/NLRP3 pathway
Journal: Exp Neurol | Authors: Yong Liu | Species: mouse | Application: WB - Modulating inflammasome (NLRP3) activation and stress granule (SG) formation: Insight of neuroprotection by Normobaric oxygen (NBO) in ischemic stroke.
Journal: Exp Neurol | Authors: Sichao Guo - Altered splicing factor and alternative splicing events in a mouse model of diet- and polychlorinated biphenyl-induced liver disease
Journal: Environ Toxicol Pharmacol | Authors: Belinda J Petri | Species: mouse | Application: WB - Distinct pathways utilized by METTL3 to regulate antiviral innate immune response
Journal: iScience | Authors: Haojie Hao | Species: human | Application: WB - DDX3X Is Hijacked by Snakehead Vesiculovirus Phosphoprotein To Facilitate Virus Replication via Stabilization of the Phosphoprotein
Journal: J Virol | Authors: Congran Bei | Application: WB,IF - The ototoxic drug cisplatin localises to stress granules altering their dynamics and composition
Journal: J Cell Sci | Authors: Jack L Martin | Species: mouse,human | Application: WB,IF - RNA Helicase DDX3 Interacts with the Capsid Protein of Hepatitis E Virus and Plays a Vital Role in the Viral Replication
Journal: Pathogens | Authors: Shaoli Lin | Species: human | Application: WB,CoIP - DDX3X alleviates doxorubicin-induced cardiotoxicity by regulating Wnt/β-catenin signaling pathway in an in vitro model.
Journal: J Biochem Mol Toxicol | Authors: Dandan Feng | Species: rat | Application: WB - Mechanism of the DDX3X/NLRP3/GSDMD Signaling Axis in Pyroptosis and Inflammatory Response in Osteoarthritis Chondrocytes.
Journal: J Biochem Mol Toxicol | Authors: Jun Shi | Species: mouse | Application: WB,CoIP - Long noncoding RNA RFPL1S-202 inhibits ovarian cancer progression by downregulating the IFN/STAT1 signaling
Journal: Exp Cell Res | Authors: Siyu Liu | Species: human | Application: WB - An ovarian phenotype of alpha 7 nicotinic receptor knockout mice
Journal: Reproduction | Authors: Pia Seßenhausen | Species: mouse | Application: IHC - Aluminum impairs cognitive function by activating DDX3X-NLRP3-mediated pyroptosis signaling pathway.
Journal: Food Chem Toxicol | Authors: Wudi Hao | Species: mouse | Application: WB,IF - Spatiotemporal characteristics of RPL24 expression in the yak oviduct and its regulatory mechanism on epithelial cell proliferation via DDX3X/DDX5
Journal: Theriogenology | Authors: Yanhu Wang | Application: WB - DEAD-Box Helicase 3 X-Linked Promotes Metastasis by Inducing Epithelial-Mesenchymal Transition via p62/Sequestosome-1.
Journal: Dig Dis Sci | Authors: Ying Zheng | Species: human | Application: WB,IHC - DDX3X Promotes Rotavirus Infection and Serves as an Antiviral Target.
Journal: Transbound Emerg Dis | Authors: Pengfei Hao | Species: human | Application: WB,IF,CoIP - The involvement of DDX3X in compression-induced nucleus pulposus pyroptosis
Journal: Biochem Biophys Res Commun | Authors: Shouyuan Chi | Species: rat,human | Application: WB,IHC - Overexpressed DDX3x promotes abdominal aortic aneurysm formation and activates AKT in ApoE knockout mice
Journal: Biochem Biophys Res Commun | Authors: Yifei Zhou | Species: mouse | Application: WB,IHC - DDX3X deficiency alleviates LPS-induced H9c2 cardiomyocytes pyroptosis by suppressing activation of NLRP3 inflammasome
Journal: Exp Ther Med | Authors: DANDAN FENG | Species: rat | Application: WB - Tumor-suppressive miRNA-135a inhibits breast cancer cell proliferation by targeting ELK1 and ELK3 oncogenes.
Journal: Genes Genomics | Authors: Akhlaq Ahmad | Species: human | Application: WB
Reviews
Write Your Own Review