MTRFR Polyclonal antibody 24646-1-AP proteintech
$149.00
In stock
SKU
24646-1-AP
| Catalog Number | 24646-1-AP |
| Synonyms | C12orf65, Mitochondrial translation release factor in rescue, My030 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive IHC detected in | human kidney tissue, human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive IHC detected in | human kidney tissue, human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag19965 Product name: Recombinant human C12orf65 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 11-94 aa of BC062329 Sequence: TPLTRICPAPWGLRLWEKLTLLSPGIAVTPVQMAGKKDYPALLSLDENELEEQFVKGHGPGGQATNKTSNCVVLKHIPSGIVVK Predict reactive species |
| Full Name | Mitochondrial translation release factor in rescue |
| Calculated Molecular Weight | 166 aa, 19 kDa |
| GenBank Accession Number | BC062329 |
| Gene Symbol | MTRFR |
| Gene ID (NCBI) | 91574 |
| RRID | AB_2879653 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H3J6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for MTRFR antibody 24646-1-AP | Download protocol |
| Citations | 1 |
| Dilutions | IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
C12orf65 participates in the process of mitochondrial translation and has been shown to be associated with a spectrum of phenotypes, including early onset optic atrophy, progressive encephalomyopathy, peripheral neuropathy, and spastic paraparesis. Protocols Product Specific Protocols IHC protocol for MTRFR antibody 24646-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Mitochondrial translation termination, recycling, reinitiation, and rescue for in-frame and out-of-frame contexts.
Journal: Nat Commun | Authors: Taisei Wakigawa
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
