| Catalog Number | 21183-1-AP |
| Synonyms | Pacer, Protein associated with UVRAG as autophagy enhancer, Protein Rubicon-like, RUBCNL |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | human skeletal muscle tissue, MCF-7 cells |
| Tested Applications — Positive IP detected in | MCF-7 cells |
| Tested Applications — Positive IHC detected in | human testis tissue, human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | U-251 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive WB detected in | human skeletal muscle tissue, MCF-7 cells |
| Positive IP detected in | MCF-7 cells |
| Positive IHC detected in | human testis tissue, human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | U-251 cells |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | human |
| Cited Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag15474 Product name: Recombinant human C13orf18 protein Source: e coli. -derived, PKG Tag: GST Domain: 1-306 aa of BC032311 Sequence: MVSQSTVRQDSPVEPWEGISDHSGIIDGSPRLLNTDHPPCQLDIRLMRHKAVWINPQDVQQQPQDLQSQVPAAGNSGTHFVTDAASPSGPSPSCLGDSLAETTLSEDTTDSVGSASPHGSSEKSSSFSLSSTEVHMVRPGYSHRVSLPTSPGILATSPYPETDSAFFEPSHLTSAADEGAVQVSRRTISSNSFSPEVFVLPVDVEKENAHFYVADMIISAMEKMKCNILSQQQTESWSKEVSGLLGSDQPDSEMTFDTNIKQESGSSTSSYSGYEGCAVLQVSPVTETRTYHDVKEICKCDVDEFV Predict reactive species |
| Full Name | chromosome 13 open reading frame 18 |
| Calculated Molecular Weight | 662 aa, 73 kDa |
| Observed Molecular Weight | 66 kDa |
| GenBank Accession Number | BC032311 |
| Gene Symbol | C13orf18 |
| Gene ID (NCBI) | 80183 |
| RRID | AB_10733098 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H714 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for C13orf18 antibody 21183-1-AP | Download protocol |
| IHC protocol for C13orf18 antibody 21183-1-AP | Download protocol |
| IP protocol for C13orf18 antibody 21183-1-AP | Download protocol |
| WB protocol for C13orf18 antibody 21183-1-AP | Download protocol |
| human | WB Precis Clin Med Blockade of Syk modulates neutrophil immune-responses via the mTOR/RUBCNL-dependent autophagy pathway to alleviate intestinal inflammation in ulcerative colitis Authors - Fengqin Zhu View Article |
| Citations | 2 |
| Dilutions | WB : 1:500-1:2000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:50-1:500 IF/ICC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
C13orf18 (also known as Pacer), now formally designated RUBCNL (Rubicon-like autophagy enhancer), is a protein containing an EF-hand calcium-binding domain with potential transporter functions. Initially identified as a candidate tumor suppressor gene, it is frequently silenced in cervical cancer due to promoter hypermethylation. Its re-expression inhibits cervical cancer cell proliferation, suggesting tumor-suppressing activity. Furthermore, research has revealed that polymorphisms in the 3'UTR region of the C13orf18 gene are associated with amyotrophic lateral sclerosis (ALS), suggesting its potential involvement in autophagy regulation and the pathogenesis of neurodegenerative diseases. Protocols Product Specific Protocols IF protocol for C13orf18 antibody 21183-1-AP Download protocol IHC protocol for C13orf18 antibody 21183-1-AP Download protocol IP protocol for C13orf18 antibody 21183-1-AP Download protocol WB protocol for C13orf18 antibody 21183-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications