MAD2L1 Polyclonal antibody 10337-1-AP proteintech
$149.00
In stock
SKU
10337-1-AP
| Catalog Number | 10337-1-AP |
| Synonyms | HSMAD2, MAD2, MAD2 like protein 1, MAD2-like protein 1, Mitotic arrest deficient 2-like protein 1 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | Daudi cells, HEK-293 cells, rat liver tissue, HepG2 cells, Raji cells, THP-1 cells, HeLa cells, L02 cells |
| Tested Applications — Positive IP detected in | HEK-293 cells |
| Tested Applications — Positive IHC detected in | mouse ovary tissue, human liver cancer tissue, human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HepG2 cells, HEK-293 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:5000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive WB detected in | Daudi cells, HEK-293 cells, rat liver tissue, HepG2 cells, Raji cells, THP-1 cells, HeLa cells, L02 cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | mouse ovary tissue, human liver cancer tissue, human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, HEK-293 cells |
| Western Blot (WB) | WB : 1:1000-1:5000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag0307 Product name: Recombinant human MAD2L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 16-185 aa of BC000356 Sequence: SAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRS Predict reactive species |
| Full Name | MAD2 mitotic arrest deficient-like 1 (yeast) |
| Calculated Molecular Weight | 24 kDa |
| Observed Molecular Weight | 25-30 kDa |
| GenBank Accession Number | BC000356 |
| Gene Symbol | MAD2L1 |
| Gene ID (NCBI) | 4085 |
| RRID | AB_2139365 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13257 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for MAD2L1 antibody 10337-1-AP | Download protocol |
| IHC protocol for MAD2L1 antibody 10337-1-AP | Download protocol |
| IP protocol for MAD2L1 antibody 10337-1-AP | Download protocol |
| WB protocol for MAD2L1 antibody 10337-1-AP | Download protocol |
| mouse | WB,IHC Cancer Res Deficiency of pRb family proteins and p53 in invasive urothelial tumorigenesis. Authors - He Feng F View Article |
| human | WB Oncogene KPNB1 inhibition disrupts proteostasis and triggers unfolded protein response-mediated apoptosis in glioblastoma cells. Authors - Zhi-Chuan Zhu View Article |
| Citations | 42 |
| Dilutions | WB : 1:1000-1:5000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:500-1:2000 IF/ICC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
MAD2 mitotic arrest deficient-like 1 (yeast) (MAD2L1, synonyms: MAD2, HSMAD2) is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. MAD2L1 is localized to human chromosome band 5q23.3 by in situ hybridization. Protocols Product Specific Protocols IF protocol for MAD2L1 antibody 10337-1-AP Download protocol IHC protocol for MAD2L1 antibody 10337-1-AP Download protocol IP protocol for MAD2L1 antibody 10337-1-AP Download protocol WB protocol for MAD2L1 antibody 10337-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- The cohesin release factor Wapl interacts with Bub3 to govern SAC activity in female meiosis I.
Journal: Sci Adv | Authors: Changyin Zhou | Species: mouse | Application: WB - ULK1 phosphorylates Mad1 to regulate spindle assembly checkpoint.
Journal: Nucleic Acids Res | Authors: Fengjie Yuan | Species: human | Application: WB,IF - Genome-wide CRISPR screen identifies BUB1 kinase as a druggable vulnerability in malignant pleural mesothelioma
Journal: Cell Death Dis | Authors: Ece Cakiroglu | Species: human | Application: IF - Loss of centromeric RNA activates the spindle assembly checkpoint in mammalian female meiosis I.
Journal: J Cell Biol | Authors: Tianyu Wu | Species: mouse | Application: IF - KPNB1 inhibition disrupts proteostasis and triggers unfolded protein response-mediated apoptosis in glioblastoma cells.
Journal: Oncogene | Authors: Zhi-Chuan Zhu | Species: human | Application: WB - Deficiency of pRb family proteins and p53 in invasive urothelial tumorigenesis.
Journal: Cancer Res | Authors: He Feng F | Species: mouse | Application: WB,IHC
Reviews
Write Your Own Review