C18orf32 Polyclonal antibody 31237-1-AP proteintech
$149.00
In stock
SKU
31237-1-AP
| Catalog Number | 31237-1-AP |
| Synonyms | C18orf32, FLJ23458, UPF0729 protein C18orf32 |
| Host | Rabbit |
| Reactivity | Human |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | U2OS cells, HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:8000 |
| Positive WB detected in | U2OS cells, HeLa cells |
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Tested Reactivity | Human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag35313 Product name: Recombinant human C18orf32 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-76 aa of NM_001199346.1 Sequence: MVCIPCIVIPVLLWIYKKFLEPYIYPLVSPFVSRIWPKKAIQESNDTNKGKVNFKGADMNGLPTKGPTEICDKKKD Predict reactive species |
| Full Name | chromosome 18 open reading frame 32 |
| Calculated Molecular Weight | 9kDa，76aa |
| Observed Molecular Weight | 12 kDa |
| GenBank Accession Number | NM_001199346.1 |
| Gene Symbol | C18orf32 |
| Gene ID (NCBI) | 497661 |
| RRID | AB_3669914 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q8TCD1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for C18orf32 antibody 31237-1-AP | Download protocol |
| Citations | - |
| Dilutions | WB : 1:1000-1:8000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
