IMUP Recombinant monoclonal antibody, PBS Only (Detector) 84148-1-PBS proteintech
$699.00
In stock
SKU
84148-1-PBS
| Catalog Number | 84148-1-PBS |
| Synonyms | C19orf33, H2RSP, HAI-2-related small protein, Hepatocyte growth factor activator inhibitor type 2-related small protein, Immortalization up-regulated protein |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag22218 Product name: Recombinant human C19orf33 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-85 aa of BC060319 Sequence: MEFDLGAALEPTSQKPGVGAGHGGDPKLSPHKVQGRSEAGAGPGPKASNFRGLGKGRRLTAAPPSSKDTTALPTPAAAPAIRTRM Predict reactive species |
| Full Name | chromosome 19 open reading frame 33 |
| Calculated Molecular Weight | 106 aa, 11 kDa |
| GenBank Accession Number | BC060319 |
| Gene Symbol | IMUP |
| Gene ID (NCBI) | 64073 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9GZP8 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 241220C2 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
