MCU/CCDC109A Polyclonal antibody 26312-1-AP proteintech
$149.00
In stock
SKU
26312-1-AP
| Catalog Number | 26312-1-AP |
| Synonyms | CCDC109A, MCU, C10orf42, Calcium uniporter protein, Calcium uniporter protein, mitochondrial |
| Host | Rabbit |
| Reactivity | human, mouse and More (1) |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, IP, ELISA |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, mouse brain tissue, rat brain tissue, HepG2 cells |
| Tested Applications — Positive IHC detected in | mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:2000-1:12000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | HeLa cells, mouse brain tissue, rat brain tissue, HepG2 cells |
| Positive IHC detected in | mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag24733 Product name: Recombinant human CCDC109A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 155-233 aa of BC034235 Sequence: DLTYHVRPPKRDLLSHENAATLNDVKTLVQQLYTTLCIEQHQLNKERELIERLEDLKEQLAPLEKVRIEISRKAEKRTT Predict reactive species |
| Full Name | coiled-coil domain containing 109A |
| Calculated Molecular Weight | 35 kDa |
| Observed Molecular Weight | 30-35 kDa |
| GenBank Accession Number | BC034235 |
| Gene Symbol | CCDC109A |
| Gene ID (NCBI) | 90550 |
| RRID | AB_2880474 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8NE86 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for MCU/CCDC109A antibody 26312-1-AP | Download protocol |
| WB protocol for MCU/CCDC109A antibody 26312-1-AP | Download protocol |
| human | WB Cell Rep A mitochondrial inside-out iron-calcium signal reveals drug targets for Parkinson's disease Authors - Vinita Bharat View Article |
| mouse | WB iScience Matrix stiffness aggravates osteoarthritis progression through H3K27me3 demethylation induced by mitochondrial damage Authors - Tianyou Kan View Article |
| Jae (Verified Customer) (12-19-2025) | works well with mouse cells Applications: Western Blot |
| Citations | 50 |
| Dilutions | WB : 1:2000-1:12000 IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
MCU, also known as CCDC109A, is highly conserved across all eukaryotes. The MCU protein is composed of two coiled-coil domains, two TMDs, and a short motif of amino acids between the two TMDs. Knockdown of MCU dramatically reduces mitochondrial Ca2+ uptake in isolated mitochondria, in permeabilized cells and living cells. MCU has 3 isoforms with MW 40,37 and 35 kDa (refer to UniProt). The observed MW of MCU is mainly between 30 to 35 kDa in paper (PMID: 26341627; 28337252). Protocols Product Specific Protocols IHC protocol for MCU/CCDC109A antibody 26312-1-AP Download protocol WB protocol for MCU/CCDC109A antibody 26312-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Ca2+-mediated mitochondrial inner membrane permeabilization induces cell death independently of Bax and Bak.
Journal: Cell Death Differ | Authors: Giovanni Quarato | Species: human | Application: WB - TDCPP and TiO2 NPs aggregates synergistically induce SH-SY5Y cell neurotoxicity by excessive mitochondrial fission and mitophagy inhibition
Journal: Environ Pollut | Authors: Ling Wang | Species: human | Application: WB - A mitochondrial inside-out iron-calcium signal reveals drug targets for Parkinson's disease
Journal: Cell Rep | Authors: Vinita Bharat | Species: human | Application: WB - Effects of MICU1-Mediated Mitochondrial Calcium Uptake on Energy Metabolism and Quality of Vitrified-Thawed Mouse Metaphase II Oocytes
Journal: Int J Mol Sci | Authors: Tianyang Lan | Species: mouse | Application: WB - Puerarin Ameliorated PCOS through Preventing Mitochondrial Dysfunction Dependent on the Maintenance of Intracellular Calcium Homeostasis
Journal: J Agric Food Chem | Authors: Yu-Si Wang | Species: mouse | Application: WB - Matrix stiffness aggravates osteoarthritis progression through H3K27me3 demethylation induced by mitochondrial damage
Journal: iScience | Authors: Tianyou Kan | Species: mouse | Application: WB - Acetylation of the Mitochondrial Chaperone GRP75 Governs ER-Mitochondrial Calcium Homeostasis and Hepatocyte Insulin Resistance.
Journal: Adv Sci (Weinh) | Authors: Danni Wang | Species: mouse | Application: WB - Sequential-targeting nanomedicine protects against acute kidney injury by modulating calcium influx and scavenging reactive oxygen species.
Journal: Biomaterials | Authors: Lili Huang | Species: mouse,human | Application: WB,IF - Ca2+-mediated mitochondrial inner membrane permeabilization induces cell death independently of Bax and Bak.
Journal: Cell Death Differ | Authors: Giovanni Quarato | Species: human | Application: WB - Cholesterol induced-mitochondrial calcium dysregulation facilitates atherosclerosis by promoting lipid accumulation in vascular smooth muscle cells.
Journal: Mol Biomed | Authors: Zhiwang Zhang | Species: mouse | Application: IF - Oxidative stress-induced mitophagy is suppressed by the miR-106b-93-25 cluster in a protective manner.
Journal: Cell Death Dis | Authors: Cheng Zhang | Species: human | Application: WB - MICU3 regulates mitochondrial Ca2+-dependent antioxidant response in skeletal muscle aging.
Journal: Cell Death Dis | Authors: Yun-Fei Yang | Species: mouse | Application: WB - Cell-type-specific dysregulation of mitochondrial calcium signaling in Alzheimer's disease.
Journal: Cell Commun Signal | Authors: Shatakshi Shukla | Species: human | Application: WB - Naringin reduces mitochondrial fragmentation and excessive mitophagy in cerebral ischemia-reperfusion injury via the S-nitrosylated Dynamin-related protein 1 (SNO-DRP1) / Leucine-rich repeat kinase 2 (LRRK2) / Mitochondrial Calcium Uniporter (MCU) pathway.
Journal: Phytomedicine | Authors: Ting Lei - ACSL4-mediated ZIP7-VDAC3 interaction regulates endoplasmic reticulum-mitochondria iron transfer in hepatocytes under PFOS exposure
Journal: Sci Total Environ | Authors: Peiyao Liang | Species: human | Application: WB - Peroxynitrite regulates ER stress-mediated Ca(2+) flux to mitochondria characterizing cardiac microvascular ischemia-reperfusion injury associated with hyperhomocysteinemia.
Journal: J Transl Med | Authors: Haipeng Liu | Species: human | Application: WB - Deregulation of ER-mitochondria contact formation and mitochondrial calcium homeostasis mediated by VDAC in fragile X syndrome
Journal: Dev Cell | Authors: Ji Geng | Species: human | Application: WB - SERCA2 dysfunction triggers hypertension by interrupting mitochondrial homeostasis and provoking oxidative stress
Journal: Free Radic Biol Med | Authors: Yaping Wang | Species: mouse | Application: WB - Redox switch C674 in SERCA2 triggers Ca(2+)-calcineurin-MCU-Drp1 cascade and pulmonary vascular remodeling.
Journal: Free Radic Biol Med | Authors: Hui Chen | Species: mouse | Application: WB,IF - Mitochondrial calcium uniporter regulates human fibroblast-like synoviocytes invasion via altering mitochondrial dynamics and dictates rheumatoid arthritis pathogenesis
Journal: Free Radic Biol Med | Authors: Lakra Promila | Species: mouse,human | Application: WB - PINK1 contained in huMSC-derived exosomes prevents cardiomyocyte mitochondrial calcium overload in sepsis via recovery of mitochondrial Ca2+ efflux.
Journal: Stem Cell Res Ther | Authors: Qin Zhou | Species: rat | Application: WB - Mitotic ER-mitochondria contact enhances mitochondrial Ca2+ influx to promote cell division
Journal: Cell Rep | Authors: Gan Zhao | Species: human | Application: WB - A mitochondrial inside-out iron-calcium signal reveals drug targets for Parkinson's disease
Journal: Cell Rep | Authors: Vinita Bharat | Species: human | Application: WB - VPS13A Deficiency Leads to Impaired Lipid Distribution and Alteration of Mitochondrial Calcium Homeostasis in Fibroblasts of VPS13A Disease Patients.
Journal: Mov Disord | Authors: Dajana Grossmann | Species: human | Application: WB - SIRT1 Alleviates Oxidative Stress-Induced Mitochondrial Dysfunction and Mitochondria-Associated Membrane Dysregulation in Stress Urinary Incontinence
Journal: Cell Prolif | Authors: Liying Chen | Species: mouse | Application: WB - TDCPP and TiO2 NPs aggregates synergistically induce SH-SY5Y cell neurotoxicity by excessive mitochondrial fission and mitophagy inhibition
Journal: Environ Pollut | Authors: Ling Wang | Species: human | Application: WB - Puerarin Ameliorated PCOS through Preventing Mitochondrial Dysfunction Dependent on the Maintenance of Intracellular Calcium Homeostasis
Journal: J Agric Food Chem | Authors: Yu-Si Wang | Species: mouse | Application: WB - Miro1 mutations disrupt cellular calcium homeostasis via dysregulation of mitochondria-ER-contact-sites, rendering iPSC-derived neurons more susceptible to lipid peroxidation.
Journal: Neurobiol Dis | Authors: Anna E. Bartalis | Species: human | Application: WB - ER-mitochondria distance is a critical parameter for efficient mitochondrial Ca2+ uptake and oxidative metabolism
Journal: Commun Biol | Authors: Giulia Dematteis | Species: human | Application: WB - TOM40 mediates the effect of TSPO on postpartum depression partially through regulating calcium homeostasis in microglia
Journal: J Affect Disord | Authors: Dong-Sheng Zhai | Species: mouse | Application: WB - TOM40 mediates the effect of TSPO on postpartum depression partially through regulating calcium homeostasis in microglia
Journal: J Affect Disord | Authors: Dong-Sheng Zhai | Species: mouse | Application: WB - NR3C1/GLMN-Mediated FKBP12.6 Ubiquitination Disrupts Calcium Homeostasis and Impairs Mitochondrial Quality Control in Stress-Induced Myocardial Damage.
Journal: Int J Mol Sci | Authors: Jingze Cong | Species: mouse | Application: WB - Effects of MICU1-Mediated Mitochondrial Calcium Uptake on Energy Metabolism and Quality of Vitrified-Thawed Mouse Metaphase II Oocytes
Journal: Int J Mol Sci | Authors: Tianyang Lan | Species: mouse | Application: WB - SMDT1 variants impair EMRE-mediated mitochondrial calcium uptake in patients with muscle involvement
Journal: Biochim Biophys Acta Mol Basis Dis | Authors: Elianne P Bulthuis | Species: human | Application: WB - EFHD1, a novel mitochondrial regulator of tumor metastasis in clear cell renal cell carcinoma
Journal: Cancer Sci | Authors: Kun Meng | Species: human | Application: WB - MICU1 attenuates neuronal apoptosis after subarachnoid hemorrhage by inhibiting mitochondrial calcium overload and damage
Journal: Cell Calcium | Authors: Jie Wang | Application: WB - MICU1 attenuates neuronal apoptosis after subarachnoid hemorrhage by inhibiting mitochondrial calcium overload and damage
Journal: Cell Calcium | Authors: Jie Wang | Application: WB - EFHD1, a novel mitochondrial regulator of tumor metastasis in clear cell renal cell carcinoma
Journal: Cancer Sci | Authors: Kun Meng | Species: human | Application: WB - RNA Interference against ATP as a Gene Therapy Approach for Prostate Cancer
Journal: Mol Pharm | Authors: Shuangya Chen | Species: mouse | Application: IHC - MICU1 alleviates hypobaric hypoxia-induced myocardial injury through regulating Ca2+ uptake to inhibit mitochondria-dependent apoptosis
Journal: Cell Signal | Authors: Yao Li | Species: mouse | Application: WB - Matrix stiffness aggravates osteoarthritis progression through H3K27me3 demethylation induced by mitochondrial damage
Journal: iScience | Authors: Tianyou Kan | Species: mouse | Application: WB - Spastin regulates ER-mitochondrial contact sites and mitochondrial homeostasis
Journal: iScience | Authors: Amelie Raby | Species: human | Application: WB - Spastin regulates ER-mitochondrial contact sites and mitochondrial homeostasis
Journal: iScience | Authors: Amelie Raby | Species: human | Application: WB - Mitochondrial calcium uniporter-mediated mitochondrial dynamics imbalance contributes to contrast medium-induced renal tubular cell injury.
Journal: Front Mol Biosci | Authors: Yangyang Chen - Sirtuin-1 Regulates Mitochondrial Calcium Uptake Through Mitochondrial Calcium Uptake 1 (MICU1)
Journal: Life (Basel) | Authors: Xinyi Zhang | Species: human | Application: WB - Modulation of Oxidized Low-density Lipoprotein-Affected Macrophage Efferocytosis by Mitochondrial Calcium Uniporter in a Murine Model
Journal: Immunol Lett | Authors: Na Lu | Species: mouse | Application: WB - Mechanism of aconitine mediated neuronal apoptosis induced by mitochondrial calcium overload caused by MCU
Journal: Toxicol Lett | Authors: Chen Jiang | Species: mouse | Application: WB,IF - Cardioprotective effect of Yiqi Huoxue decoction on post-myocardial infarction injury mediated by Ca(2+) flux through MAMs.
Journal: Front Cardiovasc Med | Authors: Yufei Li | Species: rat | Application: WB - CD137 Signal Mediates Cardiac Ischemia-Reperfusion Injury by Regulating the Necrosis of Cardiomyocytes.
Journal: J Cardiovasc Transl Res | Authors: Yao Xu | Species: mouse | Application: WB - Elevating levels of neuronal MCU in the hippocampus enhances mitochondrial calcium uptake and respiratory efficiency proportional to demand.
Journal: bioRxiv | Authors: Mikel L. Cawley | Species: mouse | Application: WB
Reviews
Write Your Own Review