C3orf10 Monoclonal antibody, PBS Only (Capture/Detector) 60663-4-PBS proteintech
$699.00
In stock
SKU
60663-4-PBS
| Catalog Number | 60663-4-PBS |
| Synonyms | Probable protein BRICK1, MDS027, HSPC300, hHBrk1, BRK1 |
| Host | Mouse |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Mouse / IgG2a |
| Tested Reactivity | human |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag33165 Product name: Recombinant human C3orf10 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-75 aa of BC019303 Sequence: MAGQEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTKGETLT Predict reactive species |
| Full Name | chromosome 3 open reading frame 10 |
| Calculated Molecular Weight | 9 kDa |
| GenBank Accession Number | BC019303 |
| Gene Symbol | C3orf10 |
| Gene ID (NCBI) | 55845 |
| Conjugate | Unconjugated |
| Purification Method | Protein A Magarose purification |
| UNIPROT ID | Q8WUW1 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG2a |
| Clonality | Monoclonal |
| Clone Number | 2E9D7 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
