MARCH8 Polyclonal antibody 14119-1-AP proteintech
$149.00
In stock
SKU
14119-1-AP
| Catalog Number | 14119-1-AP |
| Synonyms | MARCHF8, c-MIR, E3 ubiquitin-protein ligase MARCHF8, EC:2.3.2.27, MARCH-VIII |
| Host | Rabbit |
| Reactivity | human, mouse and More (3) |
| Reactivity | human, mouse, pig, monkey, zebrafish |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, IP, CoIP, ELISA |
| Applications | WB, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse testis tissue |
| Tested Applications — Positive IP detected in | mouse testis tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Positive WB detected in | mouse testis tissue |
| Positive IP detected in | mouse testis tissue |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, pig, monkey, zebrafish |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag5268 Product name: Recombinant human MARCH8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-158 aa of BC066988 Sequence: MSMPLHQISAIPSQDAISARVYRSKTKEKEREEQNEKTLGHFMSHSSNISKAGSPPSASAPAPVSSFSRTSITPSSQDICRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKYEFIMETKLKPLRKWEKLQMTSSERRKIMCS Predict reactive species |
| Full Name | membrane-associated ring finger (C3HC4) 8 |
| Calculated Molecular Weight | 33 kDa |
| Observed Molecular Weight | 30-33 kDa |
| GenBank Accession Number | BC066988 |
| Gene Symbol | MARCH8 |
| Gene ID (NCBI) | 220972 |
| RRID | AB_2140168 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q5T0T0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IP protocol for MARCH8 antibody 14119-1-AP | Download protocol |
| WB protocol for MARCH8 antibody 14119-1-AP | Download protocol |
| human | WB Cancers (Basel) MARCH8 Suppresses Tumor Metastasis and Mediates Degradation of STAT3 and CD44 in Breast Cancer Cells. Authors - Wenjing Chen View Article |
| Citations | 37 |
| Dilutions | WB : 1:500-1:1000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
MARCH8 (Membrane-associated RING finger protein 8) is also named as MIR, RNF178 and belongs to the RING zinc finger protein family. It functions as an E3 ubiquitin ligase for immune recognition-related molecules (e.g. major histocompatibility complex class I, B7-2, and ICAM-1). It plays a key role in controlling MHC class II surface expression by regulated ubiquitination of a lysine residue in the beta-chain (PMID:22761441). Protocols Product Specific Protocols IP protocol for MARCH8 antibody 14119-1-AP Download protocol WB protocol for MARCH8 antibody 14119-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- PMID: 28965816
Journal: Mol Cell | Authors: Shouheng Jin KO Validated | Species: human | Application: WB - MARCH8 inhibits influenza A virus infection by targeting viral M2 protein for ubiquitination-dependent degradation in lysosomes.
Journal: Nat Commun | Authors: Xiaoman Liu | Species: human | Application: WB - BST2 suppresses porcine epidemic diarrhea virus replication by targeting and degrading virus nucleocapsid protein with selective autophagy.
Journal: Autophagy | Authors: Ning Kong KD Validated - 2AB protein of Senecavirus A antagonizes selective autophagy and type I interferon production by degrading LC3 and MARCHF8.
Journal: Autophagy | Authors: Dage Sun KD Validated | Species: human | Application: WB - The E3 ubiquitin ligase MARCH8 negatively regulates IL-1β-induced NF-κB activation by targeting the IL1RAP coreceptor for ubiquitination and degradation.
Journal: Proc Natl Acad Sci U S A | Authors: Chen Rui R | Species: human | Application: WB - MARCH8 Suppresses Tumor Metastasis and Mediates Degradation of STAT3 and CD44 in Breast Cancer Cells.
Journal: Cancers (Basel) | Authors: Wenjing Chen | Species: human | Application: WB - O-GlcNAcylation regulates the stability of transferrin receptor (TFRC) to control the ferroptosis in hepatocellular carcinoma cells
Journal: Redox Biol | Authors: Xunyu Zhou | Species: human | Application: WB - Tetherin Suppresses Type I Interferon Signaling by Targeting MAVS for NDP52-Mediated Selective Autophagic Degradation in Human Cells.
Journal: Mol Cell | Authors: Shouheng Jin | Species: human | Application: WB - WTAP Mediated m6A Modification Stabilizes PDIA3P1 and Promotes Tumor Progression Driven by Histone Lactylation in Esophageal Squamous Cell Carcinoma
Journal: Adv Sci (Weinh) | Authors: Tao Huang | Species: human | Application: WB - FOXA1 protects against PM2.5-induced chronic lung injury via MARCHF8-dependent mitophagy inhibition.
Journal: Environ Int | Authors: Xu Wu - The E3 ubiquitin ligase MARCH8 negatively regulates IL-1β-induced NF-κB activation by targeting the IL1RAP coreceptor for ubiquitination and degradation.
Journal: Proc Natl Acad Sci U S A | Authors: Chen Rui R | Species: human | Application: WB - Transferrin receptor controls both autophagosome formation and closure via phosphatidylinositol 3-phosphate synthesis
Journal: Dev Cell | Authors: Claudia Puri | Species: human | Application: WB - miR-34a-5p/MARCHF8/ADAM10 axis in the regulation of vascular endothelial cell dysfunction and senescence
Journal: Mech Ageing Dev | Authors: Zonghao Qian | Species: human | Application: WB,IP,IF,CoIP - JWA regulates TRAIL-induced apoptosis via MARCH8-mediated DR4 ubiquitination in cisplatin-resistant gastric cancer cells.
Journal: Oncogenesis | Authors: Q Wang | Species: human | Application: WB - Membrane-Associated RING-CH 8 Functions as a Novel PD-L1 E3 Ligase to Mediate PD-L1 Degradation Induced by EGFR Inhibitors.
Journal: Mol Cancer Res | Authors: Guoqing Qian | Species: human | Application: WB - A pan-cancer analysis of MARCH8: molecular characteristics, clinical relevance, and immuno-oncology features
Journal: Cancer Biol Ther | Authors: Zihan Quan | Species: human | Application: IHC - NPR1 promotes cisplatin resistance by inhibiting PARL-mediated mitophagy-dependent ferroptosis in gastric cancer
Journal: Cell Biol Toxicol | Authors: Chengwei Wu | Species: human | Application: WB - MARCH8 downregulation modulates profibrotic responses including myofibroblast differentiation
Journal: Am J Physiol Cell Physiol | Authors: Xia Guo | Species: mouse,human | Application: WB,IHC - MARCH8 downregulation modulates profibrotic responses including myofibroblast differentiation
Journal: Am J Physiol Cell Physiol | Authors: Xia Guo | Species: mouse,human | Application: WB,IHC - Elucidating the Antiviral Mechanism of Different MARCH Factors.
Journal: mBio | Authors: Supawadee Umthong | Application: CoIP - MARCH8 Suppresses Tumor Metastasis and Mediates Degradation of STAT3 and CD44 in Breast Cancer Cells.
Journal: Cancers (Basel) | Authors: Wenjing Chen | Species: human | Application: WB - The Engineered MARCH8-Resistant Vesicular Stomatitis Virus Glycoprotein Enhances Lentiviral Vector Transduction.
Journal: Hum Gene Ther | Authors: Fengwen Xu | Species: human | Application: WB,IF - FUBP3 Degrades the Porcine Epidemic Diarrhea Virus Nucleocapsid Protein and Induces the Production of Type I Interferon.
Journal: J Virol | Authors: Sujie Dong | Species: human | Application: WB - The membrane-associated ubiquitin ligase MARCHF8 stabilizes the human papillomavirus oncoprotein E7 by degrading CUL1 and UBE2L3 in head and neck cancer
Journal: J Virol | Authors: Mohamed I Khalil | Species: mouse,human | Application: WB,IP - The membrane-associated ubiquitin ligase MARCHF8 stabilizes the human papillomavirus oncoprotein E7 by degrading CUL1 and UBE2L3 in head and neck cancer
Journal: J Virol | Authors: Mohamed I Khalil | Species: mouse,human | Application: WB,IP - TARDBP Inhibits Porcine Epidemic Diarrhea Virus Replication through Degrading Viral Nucleocapsid Protein and Activating Type I Interferon Signaling.
Journal: J Virol | Authors: Sujie Dong | Species: human | Application: WB - PABPC4 Broadly Inhibits Coronavirus Replication by Degrading Nucleocapsid Protein through Selective Autophagy.
Journal: Microbiol Spectr | Authors: Yajuan Jiao | Species: human | Application: WB - MARCH8-mediated ubiquitination regulates expression of the antiviral protein IFITM3.
Journal: J Biol Chem | Authors: Liang Wei | Species: human | Application: WB - EGR1 suppresses porcine epidemic diarrhea virus replication by regulating IRAV to degrade viral nucleocapsid protein.
Journal: J Virol | Authors: Hua Wang | Species: human | Application: WB - FUBP3 Degrades the Porcine Epidemic Diarrhea Virus Nucleocapsid Protein and Induces the Production of Type I Interferon.
Journal: J Virol | Authors: Sujie Dong | Species: human | Application: WB - MARCH8 Mediates K27-Linked Polyubiquitination of IL-7 Receptor α to Negatively Regulate IL-7-Triggered T Cell Homeostasis
Journal: J Immunol | Authors: Deng Gao | Species: human | Application: IP - MARCH8 Restricts RSV Replication by Promoting Cellular Apoptosis Through Ubiquitin-Mediated Proteolysis of Viral SH Protein
Journal: Viruses | Authors: Takashi Okura | Species: human | Application: WB,IF - NLRP12 inhibits PRRSV-2 replication by promoting GP2a degradation via MARCH8
Journal: Vet Microbiol | Authors: Huiyuan Jing | Species: human | Application: WB - Cell adhesion in zebrafish embryos is modulated by march8.
Journal: PLoS One | Authors: Mi Ha Kim | Species: zebrafish | Application: IHC - MARCH8 inhibits PRRSV-2 replication by targeting viral GP5 for proteasomal degradation at a conserved lysine 163.
Journal: Vet Microbiol | Authors: Changqing Yu | Species: pig | Application: WB - PABPC4 Inhibits SADS-CoV Replication by Degrading the Nucleocapsid Protein Through Selective Autophagy
Journal: Vet Sci | Authors: Chenchen Zhao | Species: monkey | Application: WB - The membrane-associated ubiquitin ligase MARCHF8 stabilizes the human papillomavirus oncoprotein E7 by degrading CUL1 and UBE2L3 in head and neck cancer
Journal: bioRxiv | Authors: Mohamed I Khalil | Species: human | Application: IP
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
