HIG2 Polyclonal antibody 15587-1-AP proteintech
$149.00
In stock
SKU
15587-1-AP
| Catalog Number | 15587-1-AP |
| Synonyms | C7orf68, HIG 2, HIG-2, HILPDA, Hypoxia-inducible gene 2 protein |
| Host | Rabbit |
| Reactivity | human and More (1) |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, ELISA |
| Applications | WB, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | A549 cells |
| Tested Applications — Positive IF/ICC detected in | A549 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive WB detected in | A549 cells |
| Positive IF/ICC detected in | A549 cells |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | human |
| Cited Reactivity | mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag7829 Product name: Recombinant human C7orf68 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-63 aa of BC001863 Sequence: MKHVLNLYLLGVVLTLLSIFVRVMESLEGLLESPSPGTSWTTRSQLANTEPTKGLPDHPSRSM Predict reactive species |
| Full Name | chromosome 7 open reading frame 68 |
| Calculated Molecular Weight | 7 kDa |
| Observed Molecular Weight | 7-10 kDa |
| GenBank Accession Number | BC001863 |
| Gene Symbol | C7orf68 |
| Gene ID (NCBI) | 29923 |
| RRID | AB_3669213 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y5L2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for HIG2 antibody 15587-1-AP | Download protocol |
| WB protocol for HIG2 antibody 15587-1-AP | Download protocol |
| mouse | IHC Biol Direct MYC promotes myocardial fibrosis via METTL1-mediated m7G modification of HILPDA. Authors - Yue Liu View Article |
| Citations | 1 |
| Dilutions | WB : 1:500-1:1000 IF/ICC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
HIG2 (Hypoxia inducible gene 2), also known as hypoxia inducible lipid droplet associated (HILPDA), is a gene that plays a significant role in the context of hypoxia, particularly in cancer biology. HIG2 is can be induced by hypoxia and glucose deprivation. It is expressed under low-oxygen conditions, which are common in the tumor microenvironment, and has been identified as a target gene of hypoxia-inducible factor-1 (HIF-1). HIG2 is implicated in the development and progression of various types of cancer, including renal cell carcinoma(PMID: 15930302), cell lymphoma(PMID: 26757780), epithelial ovarian cancer(PMID: 20134266), and uterine cancer(PMID: 21614900). Its expression is often elevated in these cancers and is associated with poor prognosis. Protocols Product Specific Protocols IF protocol for HIG2 antibody 15587-1-AP Download protocol WB protocol for HIG2 antibody 15587-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- MYC promotes myocardial fibrosis via METTL1-mediated m7G modification of HILPDA.
Journal: Biol Direct | Authors: Yue Liu | Species: mouse | Application: IHC
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
