EAAT2 Polyclonal antibody 22515-1-AP proteintech
$149.00
In stock
SKU
22515-1-AP
| Catalog Number | 22515-1-AP |
| Synonyms | GLT1, SLC1A2, GLT 1, Sodium-dependent glutamate/aspartate transporter 2 |
| Host | Rabbit |
| Reactivity | human, mouse, rat and More (1) |
| Reactivity | human, mouse, rat, pig |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF-P, IP, ELISA |
| Applications | WB, IF-P, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse brain tissue, HepG2 cells, rat brain tissue |
| Tested Applications — Positive IP detected in | mouse brain tissue |
| Tested Applications — Positive IF-P detected in | mouse brain tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Positive WB detected in | mouse brain tissue, HepG2 cells, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IF-P detected in | mouse brain tissue |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag18247 Product name: Recombinant human SLC1A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 460-574 aa of BC132768 Sequence: PTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYAAHNSVIVDECKVTLAANGKSADCSVEEEPWKREK Predict reactive species |
| Full Name | solute carrier family 1 (glial high affinity glutamate transporter), member 2 |
| Calculated Molecular Weight | 574 aa, 62 kDa |
| Observed Molecular Weight | 60-70 kDa, 140 kDa |
| GenBank Accession Number | BC132768 |
| Gene Symbol | EAAT2 |
| Gene ID (NCBI) | 6506 |
| RRID | AB_2879112 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P43004 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for EAAT2 antibody 22515-1-AP | Download protocol |
| IP protocol for EAAT2 antibody 22515-1-AP | Download protocol |
| WB protocol for EAAT2 antibody 22515-1-AP | Download protocol |
| mouse | WB Oxid Med Cell Longev Neuroprotective Effect of Ceftriaxone on MPTP-Induced Parkinson's Disease Mouse Model by Regulating Inflammation and Intestinal Microbiota Authors - Xiaoting Zhou View Article |
| pig | WB Neural Regen Res Astrocyte-neuron communication mediated by the Notch signaling pathway: focusing on glutamate transport and synaptic plasticity Authors - Ke-Xin Li View Article |
| Andrea (Verified Customer) (08-05-2026) | It works by WB on brain lysates Applications: Western Blot Primary Antibody Dilution: 1:10 000 Cell Tissue Type: Brain |
| Azita (Verified Customer) (05-31-2021) | The cells were subjected to SDS PAGE followed by WB and the EAAT2 antibody was used at 1:1000 dilution and was incubated overnight in 4°C. Applications: Western Blot Primary Antibody Dilution: 1/1000 Cell Tissue Type: Human primary cortical cells |
| Citations | 39 |
| Dilutions | WB : 1:5000-1:50000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IF-P : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
EAAT2 (also known as GLT-1), is encoded by SLC1A2 and is a glutamate transporter which can clear the majority of extracellular glutamate in brain and prevent brain seizures.Three isoforms of EAAT2 exist due to the alternative splicing. In addition to the 65-70 kDa monomer form, 130-150 kDa dimer of EAAT2 can also be observed on SDS-PAGE. (PMID: 22114258) Protocols Product Specific Protocols IF protocol for EAAT2 antibody 22515-1-AP Download protocol IP protocol for EAAT2 antibody 22515-1-AP Download protocol WB protocol for EAAT2 antibody 22515-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Hsp90 inhibitor HSP990 in very low dose upregulates EAAT2 and exerts potent antiepileptic activity.
Journal: Theranostics | Authors: Longze Sha | Species: mouse | Application: WB - Photobiomodulation Therapy Ameliorates Glutamatergic Dysfunction in Mice with Chronic Unpredictable Mild Stress-Induced Depression.
Journal: Oxid Med Cell Longev | Authors: Di Zhang | Species: mouse | Application: IF - HIV and drug abuse mediate astrocyte senescence in a β-catenin-dependent manner leading to neuronal toxicity.
Journal: Aging Cell | Authors: Chunjiang Yu | Species: mouse | Application: WB - Astrocyte-neuron communication mediated by the Notch signaling pathway: focusing on glutamate transport and synaptic plasticity
Journal: Neural Regen Res | Authors: Ke-Xin Li | Species: pig | Application: WB - Regulatory roles of histamine receptor in astrocytic glutamate clearance under conditions of increased glucose variability
Journal: Biochem Pharmacol | Authors: Yu Zhou | Species: mouse | Application: WB - Neuroprotective Effect of Ceftriaxone on MPTP-Induced Parkinson's Disease Mouse Model by Regulating Inflammation and Intestinal Microbiota
Journal: Oxid Med Cell Longev | Authors: Xiaoting Zhou | Species: mouse | Application: WB
Reviews
Write Your Own Review