CBX5 Recombinant monoclonal antibody, PBS Only (Detector) 83258-1-PBS proteintech
$699.00
In stock
SKU
83258-1-PBS
| Catalog Number | 83258-1-PBS |
| Synonyms | Antigen p25, HP1, HP1 alpha, HP1A |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag34810 Product name: Recombinant human CBX5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 60-120 aa of BC006821 Sequence: PELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERG Predict reactive species |
| Full Name | chromobox homolog 5 (HP1 alpha homolog, Drosophila) |
| Calculated Molecular Weight | 191 aa, 22 kDa |
| GenBank Accession Number | BC006821 |
| Gene Symbol | CBX5 |
| Gene ID (NCBI) | 23468 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P45973 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240145D4 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
