Importin Alpha 5 Polyclonal antibody 18137-1-AP proteintech
$149.00
In stock
SKU
18137-1-AP
| Catalog Number | 18137-1-AP |
| Synonyms | IMA5, KPNA1, Importin subunit alpha 1, Importin subunit alpha-5, Importin subunit alpha-5, N-terminally processed |
| Host | Rabbit |
| Reactivity | human, mouse, rat and More (2) |
| Reactivity | human, mouse, rat, pig, monkey |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP, CoIP, ELISA |
| Applications | WB, IHC, IF/ICC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HEK-293 cells, HepG2 cells |
| Tested Applications — Positive IP detected in | HEK-293 cells |
| Tested Applications — Positive IHC detected in | human testis tissue, human kidney tissue, human placenta tissue, human ovary tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HepG2 cells, MCF-7 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:5000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive WB detected in | HEK-293 cells, HepG2 cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human testis tissue, human kidney tissue, human placenta tissue, human ovary tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, MCF-7 cells |
| Western Blot (WB) | WB : 1:500-1:5000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, monkey |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag12751 Product name: Recombinant human KPNA1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 19-272 aa of BC002374 Sequence: LNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQINNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLA Predict reactive species |
| Full Name | karyopherin alpha 1 (importin alpha 5) |
| Calculated Molecular Weight | 60 kDa |
| Observed Molecular Weight | 60 kDa |
| GenBank Accession Number | BC002374 |
| Gene Symbol | Importin Alpha 5 |
| Gene ID (NCBI) | 3836 |
| RRID | AB_2133553 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P52294 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for Importin Alpha 5 antibody 18137-1-AP | Download protocol |
| IHC protocol for Importin Alpha 5 antibody 18137-1-AP | Download protocol |
| IP protocol for Importin Alpha 5 antibody 18137-1-AP | Download protocol |
| WB protocol for Importin Alpha 5 antibody 18137-1-AP | Download protocol |
| mouse,human | WB Nat Immunol Tumor-derived exosomes antagonize innate antiviral immunity. Authors - Liang Gao View Article |
| mouse | WB PLoS Biol The Transcriptional Activator Krüppel-like Factor-6 Is Required for CNS Myelination. Authors - Benjamin M Laitman KD Validated View Article |
| human | WB Nat Commun CDK5-dependent phosphorylation and nuclear translocation of TRIM59 promotes macroH2A1 ubiquitination and tumorigenicity. Authors - Youzhou Sang View Article |
| María (Verified Customer) (02-08-2022) | Works for WB (1:1000) and IF in permeabilized cells (1:100). Validated with siRNA Applications: Western Blot, Immunofluorescence Primary Antibody Dilution: 1:1000 Cell Tissue Type: RPE-1/MSC |
| Citations | 34 |
| Dilutions | WB : 1:500-1:5000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:50-1:500 IF/ICC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Importins (alpha and beta) are transport factors that transport proteins into the nucleus. alpha importins function by binding transcription factors at nuclear localization sequences (NLS), and associating with importin beta subunits to translocate through the nuclear pore. Six isoforms of alpha importins have been described in human. Importin alpha 5 is the predominant importin in adult CNS and is essential for differentiation and viability of neural cells. Protocols Product Specific Protocols IF protocol for Importin Alpha 5 antibody 18137-1-AP Download protocol IHC protocol for Importin Alpha 5 antibody 18137-1-AP Download protocol IP protocol for Importin Alpha 5 antibody 18137-1-AP Download protocol WB protocol for Importin Alpha 5 antibody 18137-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Tumor-derived exosomes antagonize innate antiviral immunity.
Journal: Nat Immunol | Authors: Liang Gao | Species: mouse,human | Application: WB - Activated PKB/GSK-3β synergizes with PKC-δ signaling in attenuating myocardial ischemia/reperfusion injury via potentiation of NRF2 activity: Therapeutic efficacy of dihydrotanshinone-I.
Journal: Acta Pharm Sin B | Authors: Hao Zeng | Species: mouse | Application: WB,IF - Nuclear-capture of endosomes depletes nuclear G-actin to promote SRF/MRTF activation and cancer cell invasion.
Journal: Nat Commun | Authors: Sergi Marco | Species: human | Application: WB - CDK5-dependent phosphorylation and nuclear translocation of TRIM59 promotes macroH2A1 ubiquitination and tumorigenicity.
Journal: Nat Commun | Authors: Youzhou Sang | Species: human | Application: WB - Loss of FCHSD1 leads to amelioration of chronic obstructive pulmonary disease.
Journal: Proc Natl Acad Sci U S A | Authors: Takahiro Kawasaki | Species: mouse | Application: WB - The Transcriptional Activator Krüppel-like Factor-6 Is Required for CNS Myelination.
Journal: PLoS Biol | Authors: Benjamin M Laitman KD Validated | Species: mouse | Application: WB - Dihydrotanshinone I preconditions myocardium against ischemic injury via PKM2 glutathionylation sensitive to ROS
Journal: Acta Pharm Sin B | Authors: Xunxun Wu | Species: mouse | Application: WB - Activated PKB/GSK-3β synergizes with PKC-δ signaling in attenuating myocardial ischemia/reperfusion injury via potentiation of NRF2 activity: Therapeutic efficacy of dihydrotanshinone-I.
Journal: Acta Pharm Sin B | Authors: Hao Zeng | Species: mouse | Application: WB,IF - PDZK1-ULK1 Axis Triggers Lipophagy to Inhibit Tumor Progression and Sunitinib Resistance in Clear Cell Renal Cell Carcinoma.
Journal: Adv Sci (Weinh) | Authors: Xuan Qi | Species: human | Application: WB,CoIP - Oncometabolite fumarate facilitates PD-L1 expression and immune evasion in clear cell renal cell carcinoma
Journal: Cell Death Dis | Authors: Yi Gao | Species: human | Application: WB - Doublecortin undergo nucleocytoplasmic transport via the RanGTPase signaling to promote glioma progression.
Journal: Cell Commun Signal | Authors: Abiola Abdulrahman Ayanlaja | Species: rat,human | Application: WB,IP - Loss of FCHSD1 leads to amelioration of chronic obstructive pulmonary disease.
Journal: Proc Natl Acad Sci U S A | Authors: Takahiro Kawasaki | Species: mouse | Application: WB - FAK-mediated phosphorylation at Y464 regulates p85β nuclear translocation to promote tumorigenesis of ccRCC by repressing RB1 expression
Journal: Cell Rep | Authors: Yanhua Zhang | Species: human | Application: WB,IP - Respiratory syncytial virus NS1 inhibits anti-viral Interferon-α-induced JAK/STAT signaling, by limiting the nuclear translocation of STAT1
Journal: Front Immunol | Authors: Claudia Efstathiou | Species: human | Application: WB,IP - The Transcriptional Activator Krüppel-like Factor-6 Is Required for CNS Myelination.
Journal: PLoS Biol | Authors: Benjamin M Laitman | Species: mouse | Application: WB - Baicalin confers hepatoprotective effect against alcohol-associated liver disease by upregulating microRNA-205.
Journal: Int Immunopharmacol | Authors: Long Fang | Species: mouse | Application: WB - STAT3 Regulates the Type I IFN-Mediated Antiviral Response by Interfering with the Nuclear Entry of STAT1.
Journal: Int J Mol Sci | Authors: Huanru Wang | Species: mouse | Application: WB - Ivermectin ameliorates acute myocarditis via the inhibition of importin-mediated nuclear translocation of NF-κB/p65
Journal: Int Immunopharmacol | Authors: Xu Gao | Species: mouse | Application: WB,CoIP - Inhibition of Nuclear Transport of NF-ĸB p65 by the Salmonella Type III Secretion System Effector SpvD.
Journal: PLoS Pathog | Authors: Nathalie Rolhion | Application: WB - SV40 exploits the Nesprin-2-SUN1-KPNA4 axis for stepwise targeting and entry into the host nucleus to promote infection.
Journal: PLoS Pathog | Authors: Luke Gohmann | Species: monkey | Application: WB - African Swine Fever Virus MGF360-12L Inhibits Type I Interferon Production by Blocking the Interaction of Importin α and NF-κB Signaling Pathway.
Journal: Virol Sin | Authors: Yisha Zhuo | Species: human | Application: WB - The intracellular domain of the epilepsy protein PCDH19 regulates spine density in cortical neurons in vivo via Xlr genes.
Journal: J Neurosci | Authors: Sylvia A. Newbold - The subcellular distribution of HDAC1 in neurotoxic conditions is dependent on serine phosphorylation.
Journal: J Neurosci | Authors: Yunjiao Zhu | Species: mouse | Application: WB - Targeted disruption of one of the importin α family members leads to female functional incompetence in delivery.
Journal: FEBS J | Authors: Moriyama Tetsuji T | Species: mouse | Application: IHC - Direct Observation of Importin α Family Member KPNA1 in Axonal Transport With or Without a Schizophrenia-Related Mutation
Journal: J Biol Chem | Authors: Katsutoshi Mizuno | Species: mouse | Application: WB,IP,IF - CSE1L promotes nuclear accumulation of transcriptional coactivator TAZ and enhances invasiveness of human cancer cells.
Journal: J Biol Chem | Authors: Shunta Nagashima | Species: human | Application: WB - ΔNp63 Regulates Radioresistance in Human Head and Neck Squamous Carcinoma Cells
Journal: Curr Issues Mol Biol | Authors: Kota Sato | Species: human | Application: WB - Porcine deltacoronavirus nucleocapsid protein antagonizes JAK-STAT signaling pathway by targeting STAT1 through KPNA2 degradation
Journal: J Virol | Authors: Yating Hu | Species: pig,human | Application: WB - Nup210 Promotes Colorectal Cancer Progression by Regulating Nuclear Plasma Transport
Journal: Lab Invest | Authors: Fangyi Han | Application: IF - Ivermectin Inhibits HBV Entry into the Nucleus by Suppressing KPNA2
Journal: Viruses | Authors: Anna Nakanishi | Species: human | Application: WB - PACS-1 contains distinct motifs for nuclear-cytoplasmic transport and interacts with the RNA-binding protein PTBP1 in the nucleus and cytosol
Journal: FEBS Lett | Authors: Steven M. Trothen | Species: human | Application: WB,CoIP - Karyopherin Alpha Proteins Regulate Oligodendrocyte Differentiation.
Journal: PLoS ONE | Authors: Benjamin M Laitman | Species: mouse | Application: WB - SV40 exploits the Nesprin-2-SUN1-KPNA4 axis for stepwise targeting and entry into the host nucleus to promote infection.
Journal: bioRxiv | Authors: Luke Gohmann | Species: monkey | Application: WB - Nuclear pore heterogeneity influences HIV-1 infection and the antiviral activity of MX2.
Journal: Elife | Authors: Melissa Kane | Species: human | Application: WB
Reviews
Write Your Own Review