CEP89, CCDC123 Polyclonal antibody 24002-1-AP proteintech
$149.00
In stock
SKU
24002-1-AP
| Catalog Number | 24002-1-AP |
| Synonyms | CCDC123, CEP89, Centrosomal protein 123, Centrosomal protein of 89 kDa, Cep123 |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | SH-SY5Y cells, Neuro-2a cells |
| Tested Applications — Positive IF/ICC detected in | U-251 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:200-1:1000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive WB detected in | SH-SY5Y cells, Neuro-2a cells |
| Positive IF/ICC detected in | U-251 cells |
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag21206 Product name: Recombinant human CCDC123 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 248-343 aa of BC136328 Sequence: MDLNNMNQSLTLELNTMKQAMKELQLKLKGMEKEKRKLKEAEKASSQEVAAPELLYLRKQAQELVDENDGLKMTVHRLNVELSRYQTKFRHLSKEE Predict reactive species |
| Full Name | coiled-coil domain containing 123 |
| Calculated Molecular Weight | 783 aa, 90 kDa |
| Observed Molecular Weight | 85-100 kDa, 40 kDa |
| GenBank Accession Number | BC136328 |
| Gene Symbol | CEP89 |
| Gene ID (NCBI) | 84902 |
| RRID | AB_2879400 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96ST8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for CEP89, CCDC123 antibody 24002-1-AP | Download protocol |
| WB protocol for CEP89, CCDC123 antibody 24002-1-AP | Download protocol |
| mouse | WB,IF Cell Res NudCL2 is an autophagy receptor that mediates selective autophagic degradation of CP110 at mother centrioles to promote ciliogenesis. Authors - Min Liu View Article |
| human | WB,IF Elife Myristoylated Neuronal Calcium Sensor-1 captures the preciliary vesicle at distal appendages Authors - Tomoharu Kanie KO Validated View Article |
| Citations | 5 |
| Dilutions | WB : 1:200-1:1000 IF/ICC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
CCDC123(as known as CEP123), also named as CEP89, is a new player in the process of primary ciliogenesis and it also plays a role in mitochondrial metabolism where it may modulate complex IV activity. It has been shown that CEP123 is localized to the distal appendages of the mother centriolecep and the localization of CEP123 is cell cycle-dependent with its levels decreasing during mitosis. CEP123 depletion can cause defects in ciliary vesicle formationcep and prevent the formation of a ciliary vesicle at the distal end of the mother centriole. It is possible that CEP123 is involved in regulating the recruitment of membranes to the centrosome through its interaction with Cep290(PMID:23575228, 23789104, 23348840). 24002-1-AP antibody recognizes all of CEP123 isoforms. Protocols Product Specific Protocols IF protocol for CEP89, CCDC123 antibody 24002-1-AP Download protocol WB protocol for CEP89, CCDC123 antibody 24002-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- NudCL2 is an autophagy receptor that mediates selective autophagic degradation of CP110 at mother centrioles to promote ciliogenesis.
Journal: Cell Res | Authors: Min Liu | Species: mouse | Application: WB,IF - The CEP19-RABL2 GTPase Complex Binds IFT-B to Initiate Intraflagellar Transport at the Ciliary Base.
Journal: Dev Cell | Authors: Tomoharu Kanie | Species: human | Application: IF - The evolutionary conserved proteins CEP90, FOPNL, and OFD1 recruit centriolar distal appendage proteins to initiate their assembly
Journal: PLoS Biol | Authors: Pierrick Le Borgne | Species: human | Application: IF - A hierarchical pathway for assembly of the distal appendages that organize primary cilia
Journal: Elife | Authors: Tomoharu Kanie | Species: human | Application: WB,IF - Myristoylated Neuronal Calcium Sensor-1 captures the preciliary vesicle at distal appendages
Journal: Elife | Authors: Tomoharu Kanie KO Validated | Species: human | Application: WB,IF
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
