Mouse CCL7/MCP-3 Recombinant monoclonal antibody, PBS Only (Capture) 86501-1-PBS proteintech
$699.00
In stock
SKU
86501-1-PBS
| Catalog Number | 86501-1-PBS |
| Synonyms | C-C motif chemokine 7, Ccl7, Fic, Intercrine/chemokine MARC, Mcp3 |
| Host | Rabbit |
| Reactivity | mouse |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Sandwich ELISA, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | mouse |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg4626 Product name: Recombinant Mouse CCL7/MCP-3 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 24-97 aa of NM_013654.3 Sequence: QPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP Predict reactive species |
| Full Name | chemokine (C-C motif) ligand 7 |
| Calculated Molecular Weight | 11kDa |
| GenBank Accession Number | NM_013654.3 |
| Gene Symbol | Ccl7 |
| Gene ID (NCBI) | 20306 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q03366 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 250662A1 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
