CCNJL Polyclonal antibody 26743-1-AP proteintech
$149.00
In stock
SKU
26743-1-AP
| Catalog Number | 26743-1-AP |
| Synonyms | Cyclin-J-like protein, Cyclin J like protein, cyclin J like |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse liver tissue, rat liver tissue |
| Tested Applications — Positive IF/ICC detected in | HepG2 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive WB detected in | mouse liver tissue, rat liver tissue |
| Positive IF/ICC detected in | HepG2 cells |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag25048 Product name: Recombinant human CCNJL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-52 aa of BC013353 Sequence: PALGQPATTLAQFQTPVQDLCLAYRDSLQAHRS Predict reactive species |
| Full Name | cyclin J-like |
| Calculated Molecular Weight | 435 aa, 48 kDa |
| Observed Molecular Weight | 48 kDa |
| GenBank Accession Number | BC013353 |
| Gene Symbol | CCNJL |
| Gene ID (NCBI) | 79616 |
| RRID | AB_3085900 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8IV13 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for CCNJL antibody 26743-1-AP | Download protocol |
| WB protocol for CCNJL antibody 26743-1-AP | Download protocol |
| Citations | - |
| Dilutions | WB : 1:500-1:1000 IF/ICC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |