CCR3 Polyclonal antibody 22351-1-AP proteintech
$149.00
In stock
SKU
22351-1-AP
| Catalog Number | 22351-1-AP |
| Synonyms | C C chemokine receptor type 3, C C CKR 3, CC CKR 3, CCR 3, CCR3, CD193, CKR3, CMKBR3, Eosinophil eotaxin receptor |
| Host | Rabbit |
| Reactivity | human and More (1) |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | IHC, IF, ELISA |
| Applications | IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive IHC detected in | human tonsillitis tissue, human lymphoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
| Positive IHC detected in | human tonsillitis tissue, human lymphoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag17926 Product name: Recombinant human CCR3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 310-354 aa of BC110297 Sequence: KYLRHFFHRHLLMHLGRYIPFLPSEKLERTSSVSPSTAEPELSIV Predict reactive species |
| Full Name | chemokine (C-C motif) receptor 3 |
| Calculated Molecular Weight | 355 aa, 41 kDa |
| GenBank Accession Number | BC110297 |
| Gene Symbol | CCR3 |
| Gene ID (NCBI) | 1232 |
| RRID | AB_2879085 |
| Conjugate | Unconjugated |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | P51677 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for CCR3 antibody 22351-1-AP | Download protocol |
| mouse | IF Theranostics CD34+ PI16+ fibroblast progenitors aggravate neointimal lesions of allograft arteries via CCL11/CCR3-PI3K/AKT pathway Authors - Xiaodong Xu View Article |
| human | IHC Sci Rep Immuno-transcriptomic analysis based on machine learning identifies immunity signature genes of chronic rhinosinusitis with nasal polyps Authors - Zhaonan Xu View Article |
| human,mouse | IHC Oncol Rep SYNPO2 promotes the development of BLCA by upregulating the infiltration of resting mast cells and increasing the resistance to immunotherapy Authors - Gongjie Ye View Article |
| Citations | 4 |
| Dilutions | IHC : 1:100-1:400 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Publications
- Emu oil alleviates atopic dermatitis-like responses by inhibiting Cdc42 signaling of keratinocyte
Journal: Int Immunopharmacol | Authors: Lingwei Bu | Species: mouse | Application: IHC - Immuno-transcriptomic analysis based on machine learning identifies immunity signature genes of chronic rhinosinusitis with nasal polyps
Journal: Sci Rep | Authors: Zhaonan Xu | Species: human | Application: IHC - SYNPO2 promotes the development of BLCA by upregulating the infiltration of resting mast cells and increasing the resistance to immunotherapy
Journal: Oncol Rep | Authors: Gongjie Ye | Species: human,mouse | Application: IHC - CD34+ PI16+ fibroblast progenitors aggravate neointimal lesions of allograft arteries via CCL11/CCR3-PI3K/AKT pathway
Journal: Theranostics | Authors: Xiaodong Xu | Species: mouse | Application: IF
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
