CCS Polyclonal antibody 22802-1-AP proteintech
$149.00
In stock
SKU
22802-1-AP
| Catalog Number | 22802-1-AP |
| Synonyms | Superoxide Dismutase 4 |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HepG2 cells |
| Tested Applications — Positive IP detected in | HepG2 cells |
| Tested Applications — Positive IHC detected in | mouse brain tissue, human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HepG2 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive WB detected in | HepG2 cells |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | mouse brain tissue, human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag18850 Product name: Recombinant human CCS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-274 aa of BC105016 Sequence: MASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL Predict reactive species |
| Full Name | copper chaperone for superoxide dismutase |
| Calculated Molecular Weight | 274 aa, 29 kDa |
| Observed Molecular Weight | 34 kDa |
| GenBank Accession Number | BC105016 |
| Gene Symbol | CCS |
| Gene ID (NCBI) | 9973 |
| RRID | AB_2879172 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O14618 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for CCS antibody 22802-1-AP | Download protocol |
| IHC protocol for CCS antibody 22802-1-AP | Download protocol |
| IP protocol for CCS antibody 22802-1-AP | Download protocol |
| WB protocol for CCS antibody 22802-1-AP | Download protocol |
| human | IHC Cancer Lett The E3 ligase TRIM22 functions as a tumor suppressor in breast cancer by targeting CCS for proteasomal degradation to inhibit STAT3 signaling Authors - Yunkai Yang View Article |
| mouse | WB J Nanobiotechnology Rationally designed catalytic nanoplatform for enhanced chemoimmunotherapy via deploying endogenous plus exogenous copper and remodeling tumor microenvironment Authors - Daxi Sun View Article |
| Citations | 15 |
| Dilutions | WB : 1:500-1:2000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:50-1:500 IF/ICC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Copper chaperone for superoxide dismutase (CCS) is a soluble factor that converts copper into copper-zinc superoxide dismutase ( SOD1 ). CCS and SOD1 interact directly in vivo and in vitro, and this interaction is mediated by homologous domains in each protein. CCS not only interacts with wild-type SOD1 but also interacts with SOD1 containing common missense mutations, resulting in FALS. Protocols Product Specific Protocols IF protocol for CCS antibody 22802-1-AP Download protocol IHC protocol for CCS antibody 22802-1-AP Download protocol IP protocol for CCS antibody 22802-1-AP Download protocol WB protocol for CCS antibody 22802-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Disrupting Mitochondrial Copper Distribution Inhibits Leukemic Stem Cell Self-Renewal.
Journal: Cell Stem Cell | Authors: Rashim Pal Singh | Species: human | Application: WB - The M1311V variant of ATP7A is associated with impaired trafficking and copper homeostasis in models of motor neuron disease.
Journal: Neurobiol Dis | Authors: Nadine Bakkar | Species: human | Application: WB - S-acylation of SOD1, CCS, and a stable SOD1-CCS heterodimer in human spinal cords from ALS and non-ALS subjects.
Journal: Sci Rep | Authors: Sarah E Antinone | Species: mouse | Application: WB - Adaptive protein synthesis in genetic models of copper deficiency and childhood neurodegeneration
Journal: Mol Biol Cell | Authors: Alicia R Lane | Species: human | Application: WB - Rationally designed catalytic nanoplatform for enhanced chemoimmunotherapy via deploying endogenous plus exogenous copper and remodeling tumor microenvironment
Journal: J Nanobiotechnology | Authors: Daxi Sun | Species: mouse | Application: WB - The E3 ligase TRIM22 functions as a tumor suppressor in breast cancer by targeting CCS for proteasomal degradation to inhibit STAT3 signaling
Journal: Cancer Lett | Authors: Yunkai Yang | Species: human | Application: IHC
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
