Cytokeratin 7 Polyclonal antibody 15539-1-AP proteintech
$149.00
In stock
SKU
15539-1-AP
| Catalog Number | 15539-1-AP |
| Synonyms | KRT7, CK 7, CK7, CK-7, Cytokeratin,Keratin |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, rat liver tissue, A431 cells, mouse liver tissue, mouse bladder tissue, HepG2 cells, mouse lung tissue, rat bladder tissue, rat lung tissue |
| Tested Applications — Positive IHC detected in | human pancreas tissue, human bowen disease, human breast cancer tissue, human kidney tissue, human lung tissue, human lung cancer tissue, human ovary tumor tissue, human stomach cancer tissue, mouse kidney tissue, mouse pancreas tissue, rat kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF-P detected in | mouse pancreas tissue, rat liver tissue |
| Tested Applications — Positive IF-Fro detected in | mouse breast cancer |
| Tested Applications — Positive IF/ICC detected in | HeLa cells |
| Tested Applications — Positive FC (Intra) detected in | HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:1000-1:30000 |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)-FRO | IF-FRO : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Recommended Dilutions — Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension |
| Positive WB detected in | HeLa cells, rat liver tissue, A431 cells, mouse liver tissue, mouse bladder tissue, HepG2 cells, mouse lung tissue, rat bladder tissue, rat lung tissue |
| Positive IHC detected in | human pancreas tissue, human bowen disease, human breast cancer tissue, human kidney tissue, human lung tissue, human lung cancer tissue, human ovary tumor tissue, human stomach cancer tissue, mouse kidney tissue, mouse pancreas tissue, rat kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse pancreas tissue, rat liver tissue |
| Positive IF-Fro detected in | mouse breast cancer |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:30000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag7895 Product name: Recombinant human CK7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC002700 Sequence: MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINRRTAAENEFVVLKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDAR Predict reactive species |
| Full Name | keratin 7 |
| Calculated Molecular Weight | 469 aa, 51 kDa |
| Observed Molecular Weight | 51 kDa |
| GenBank Accession Number | BC002700 |
| Gene Symbol | Cytokeratin 7 |
| Gene ID (NCBI) | 3855 |
| RRID | AB_2249769 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P08729 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| FC protocol for Cytokeratin 7 antibody 15539-1-AP | Download protocol |
| IF protocol for Cytokeratin 7 antibody 15539-1-AP | Download protocol |
| IHC protocol for Cytokeratin 7 antibody 15539-1-AP | Download protocol |
| WB protocol for Cytokeratin 7 antibody 15539-1-AP | Download protocol |
| mouse | IHC Cancer Cell Promotion of cholangiocarcinoma growth by diverse cancer-associated fibroblast subpopulations. Authors - Silvia Affo View Article |
| human | WB,IHC,IF Cell Death Dis LIF upregulates poFUT1 expression and promotes trophoblast cell migration and invasion at the fetal-maternal interface. Authors - S Liu View Article |
| Citations | 46 |
| Dilutions | WB : 1:5000-1:50000 IHC : 1:1000-1:30000 IF-P : 1:50-1:500 IF-FRO : 1:50-1:500 IF/ICC : 1:50-1:500 FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Cytokeratin 7 (CK7) is a type II keratin protein that is a principal constituent of the intermediate filament cytoskeleton. It is primarily expressed in simple epithelia lining the cavities of internal organs, glandular ducts, and blood vessels. Abnormal expression of CK7 has been linked to various pathological conditions, including cancer. Overexpression of CK7 promotes tumor progression and metastasis in different human cancers, and its suppression leads to rapid tumor regression, highlighting its potential as a therapeutic target CK7 is also involved in inhibiting interferon-dependent interphase, promoting DNA synthesis, initiating translation possibly through interaction with p150 (the largest subunit of eukaryotic translation initiation factor 3), and interacting with G protein-coupled estrogen receptor 1 (GPER1), which activates several signaling pathways. In the context of cancer diagnosis, CK7 is used as a marker to distinguish between different types of carcinomas. It is expressed in most adenocarcinomas, particularly those of the lung and colorectal origin, and is useful in differentiating primary ovarian carcinoma from metastatic colorectal carcinoma. CK7 expression has also been studied as a predictor of an unfavorable prognosis in colorectal carcinoma. Protocols Product Specific Protocols FC protocol for Cytokeratin 7 antibody 15539-1-AP Download protocol IF protocol for Cytokeratin 7 antibody 15539-1-AP Download protocol IHC protocol for Cytokeratin 7 antibody 15539-1-AP Download protocol WB protocol for Cytokeratin 7 antibody 15539-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Promotion of cholangiocarcinoma growth by diverse cancer-associated fibroblast subpopulations.
Journal: Cancer Cell | Authors: Silvia Affo | Species: mouse | Application: IHC - Neurulation of the cynomolgus monkey embryo achieved from 3D blastocyst culture
Journal: Cell | Authors: Jinglei Zhai | Application: IF - Defective O-fucosylation of EDIL3 attenuates invasion and vascular remodeling of trophoblasts via LIFR signaling pathway in preeclampsia.
Journal: Nat Commun | Authors: Yaqi Li | Species: human | Application: IF - Identifying fibroblast-derived sFRP2 as a therapeutic target and engineering siRNA therapy for uterine scarring
Journal: Nat Commun | Authors: Juan Cheng | Application: IF - GelMA loaded with exosomes from human minor salivary gland organoids enhances wound healing by inducing macrophage polarization
Journal: J Nanobiotechnology | Authors: Jiaying Qian | Species: human | Application: IF - LIF upregulates poFUT1 expression and promotes trophoblast cell migration and invasion at the fetal-maternal interface.
Journal: Cell Death Dis | Authors: S Liu | Species: human | Application: WB,IHC,IF - LIF upregulates poFUT1 expression and promotes trophoblast cell migration and invasion at the fetal-maternal interface.
Journal: Cell Death Dis | Authors: S Liu | Species: human | Application: WB,IHC,IF - Macrophages originated IL-33/ST2 inhibits ferroptosis in endometriosis via the ATF3/SLC7A11 axis
Journal: Cell Death Dis | Authors: Qiong Wu | Species: human | Application: IF - α1,3-fucosylation of MEST promotes invasion potential of cytotrophoblast cells by activating translation initiation
Journal: Cell Death Dis | Authors: Hao Wang | Species: human | Application: IF - Simvastatin Restores Uteroplacental Hemodynamics and Trophoblast Function in Obstetric Antiphospholipid Syndrome in a Placenta-on-a-Chip Model.
Journal: Adv Healthc Mater | Authors: Hongli Liu | Species: human | Application: IF - PANoptosis subtypes predict prognosis and immune efficacy in gastric cancer
Journal: Apoptosis | Authors: Zitao Liu | Species: human | Application: WB,IHC,IF - PYK2 promotes cell proliferation and epithelial-mesenchymal transition in endometriosis by phosphorylating Snail1
Journal: Mol Med | Authors: Lu Liu | Species: human | Application: IF - Pasteurized Akkermansia muciniphila ameliorates preeclampsia via inhibiting mitochondrial dysfunction-mediated placental apoptosis in vivo and in vitro
Journal: Free Radic Biol Med | Authors: Haizhen Wang | Species: mouse | Application: IF - Combining TIGIT blockade with IL-15 stimulation is a promising immunotherapy strategy for lung adenocarcinoma
Journal: Clin Transl Med | Authors: Baohong Luo | Species: human | Application: IF - Establishment of human trophoblast stem cells from human induced pluripotent stem cell-derived cystic cells under micromesh culture.
Journal: Stem Cell Res Ther | Authors: Zhuosi Li | Species: human | Application: IF - Huang Qi Decoction Prevents BDL-Induced Liver Fibrosis Through Inhibition of Notch Signaling Activation.
Journal: Am. J. Chin. Med. | Authors: Xiao Zhang | Species: human | Application: IHC - BM-MSCs overexpressing the Numb enhance the therapeutic effect on cholestatic liver fibrosis by inhibiting the ductular reaction
Journal: Stem Cell Res Ther | Authors: Yan-Nan Xu | Species: rat | Application: WB,IF - CCL20/CCR6 axis mediates macrophages to promote proliferation and migration of ESCs by blocking autophagic flux in endometriosis
Journal: Stem Cell Res Ther | Authors: Jiahuan Tan | Species: human | Application: IF - CXCL5 Downregulation in Villous Tissue Is Correlated With Recurrent Spontaneous Abortion
Journal: Front Immunol | Authors: Sainan Zhang | Species: human | Application: IF - Fuzheng Huayu formula attenuates ductular reaction and liver fibrosis potentially through suppressing Gli1 pathway.
Journal: J Ethnopharmacol | Authors: Yonghong Hu | Species: mouse,rat | Application: IHC - Total astragalus saponins enhance the anti-liver fibrosis efficacy of Numb-overexpressed hUC-MSCs through stabilizing the Numb-p53 axis.
Journal: J Ethnopharmacol | Authors: Shi-Hao Zhang | Species: rat | Application: IHC - Astragaloside prevents BDL-induced liver fibrosis through inhibition of notch signaling activation.
Journal: J Ethnopharmacol | Authors: Mu Yongping | Species: rat | Application: IHC - Bushen Antai recipe attenuates recurrent spontaneous abortion by activating VEGFA/p-AKT/SESN2 to restore trophoblast endoplasmic reticulum homeostasis.
Journal: J Ethnopharmacol | Authors: Zhuo Liu | Species: mouse | Application: IF - Blue light pollution induces dry eye by damaging conjunctival stem cells through cAMP-PKA-Pax6 signaling pathway
Journal: Ecotoxicol Environ Saf | Authors: Lingyu Zhang | Application: WB,IF - OTUB2/NR4A1 restrains the development of preeclampsia by suppressing macrophage M1 polarization
Journal: Commun Biol | Authors: Yue Wang | Application: IHC,IF - Modulatory effects of trophoblast-secreted CXCL12 on the migration and invasion of human first-trimester decidual epithelial cells are mediated by CXCR4 rather than CXCR7.
Journal: Reprod Biol Endocrinol | Authors: Jiayi Zheng | Species: human | Application: IHC - Toll-like receptor 4 inhibition by pyridostigmine is associated with a reduction in hypertension and inflammation in rat models of preeclampsia
Journal: J Hypertens | Authors: Md Ahasan Ali | Species: human | Application: IF - A Novel Model for Papillomavirus-Mediated Anal Disease and Cancer Using the Mouse Papillomavirus.
Journal: mBio | Authors: Simon Blaine-Sauer | Species: mouse | Application: IHC - Reduced Wiskott-Aldrich syndrome protein expression in preeclampsia placenta impairs trophoblast syncytialization by modulating syncytin-2 via FAK/β-catenin pathway.
Journal: Front Cell Dev Biol | Authors: Shuo Zhang | Species: human | Application: IHC - AdipoRon ameliorates synovial inflammatory lesions and joint destruction in experimental arthritis by downregulating KRT7.
Journal: Eur J Pharm Sci | Authors: Chen Jiang | Species: human, rat | Application: IF - Numb-exon3 and full length Numb equivalently alleviate cholestatic liver fibrosis by inhibiting ductular reaction.
Journal: Sci Rep | Authors: Yan-nan Xu | Species: rat | Application: WB,IHC - Dihydroartemisinin-Loaded ZIF-8 Nanoparticles Elicit Chemo-Immunotherapy against Malignant Pleural Effusion via Inhibition of OCT4/M-CSF Signaling Pathway.
Journal: Mol Pharm | Authors: Hui You | Species: human | Application: IF - USP18 promotes clear cell renal cell carcinoma progression by regulating the ubiquitination and stability of YBX3.
Journal: iScience | Authors: Chen Wang | Species: human | Application: IF - Cooperation between PRMT1 and PRMT6 drives lung cancer health disparities among Black/African American men
Journal: iScience | Authors: Pei-Ying Wu | Species: mouse | Application: IHC - Uterine artery dysfunction in pregnant ACE2 knockout mice is associated with placental hypoxia and reduced umbilical blood flow velocity.
Journal: Am J Physiol Endocrinol Metab | Authors: Liliya M Yamaleyeva - Exploratory study on the role of Clonorchis sinensis infection in promoting cholangiocarcinoma progression.
Journal: Parasit Vectors | Authors: Shitao Li | Species: rat | Application: IHC - Exploratory study on the role of Clonorchis sinensis infection in promoting cholangiocarcinoma progression.
Journal: Parasit Vectors | Authors: Shitao Li | Species: rat | Application: IHC - Establishment and characterization of an immortalized epithelial cell line from human gallbladder
Journal: Front Oncol | Authors: Ziyi Wang | Species: human | Application: WB - AARS1 promotes endometriosis progression by promoting the lactylation of Snail1†.
Journal: Biol Reprod | Authors: Lan Liu | Species: human | Application: IF - Role of poFUT1 and O-fucosylation in placental angiogenesis
Journal: Biol Reprod | Authors: Caixia Liang | Species: human | Application: IHC - Elevated PGT promotes proliferation and inhibits cell apoptosis in preeclampsia by Erk signaling pathway
Journal: Mol Cell Probes | Authors: Huiyuan Pang | Species: human | Application: IF - Reduced level of BMI1 inhibits trophoblast proliferation and migration via the epigenetic enhancement of CSTA and TGFB2 in spontaneous abortion
Journal: Placenta | Authors: Huimin Li | Species: human | Application: IF - A Novel Method to Repair Thin Endometrium and Restore Fertility Based on Menstruation-Derived Stem Cell
Journal: Reprod Sci | Authors: Kai Chen | Species: rat | Application: IF - Comparison of clinical manifestations and immunoreactivities of Meckel's diverticulum with and without gastric heteroplasia
Journal: Front Pediatr | Authors: Ting Ting Zhang | Species: human | Application: IHC - [Overexpression of Numb gene can inhibit the progression of biliary liver fibrosis in adult liver].
Journal: Zhonghua Gan Zang Bing Za Zhi | Authors: 许燕楠 | Species: rat | Application: IF - The chromatin remodeling complex PRC2 safeguards cell fate in alveolar epithelial type 2 cells.
Journal: bioRxiv | Authors: Helen I. Warheit-Niemi - HIF-1 signaling contributes to lenvatinib resistance in patient-derived HCC organoids.
Journal: Genomics | Authors: Yongye Huang
Reviews
Write Your Own Review