CD164 Recombinant monoclonal antibody, PBS Only 84598-4-PBS proteintech
$699.00
In stock
SKU
84598-4-PBS
| Catalog Number | 84598-4-PBS |
| Synonyms | MGC-24, MGC-24v, MUC-24, Multi-glycosylated core protein 24 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg1690 Product name: Recombinant Human CD164 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 24-162 aa of NM_006016.6 Sequence: DKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD Predict reactive species |
| Full Name | CD164 molecule, sialomucin |
| Calculated Molecular Weight | 21kDa |
| GenBank Accession Number | NM_006016.6 |
| Gene Symbol | CD164 |
| Gene ID (NCBI) | 8763 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q04900-1 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 241951E9 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
