| Catalog Number | CL594-98032 |
| Synonyms | 240354D2, CD28 molecule, T-cell-specific surface glycoprotein CD28, Tp44 |
| Host | Rabbit |
| Reactivity | human, cynomolgus monkey |
| Form | Liquid |
| Formulation | PBS, Azide, BSA |
| Applications | FC |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive FC detected in | human PBMCs |
| Positive FC detected in | human PBMCs |
| Flow Cytometry (FC) | FC : 5 ul per 10^6 cells in 100 μl suspension |
| Tested Reactivity | human, cynomolgus monkey |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg0889 Product name: Recombinant Human CD28 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 19-152 aa of BC093698 Sequence: NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP Predict reactive species |
| Full Name | CD28 molecule |
| Calculated Molecular Weight | 220 aa, 25 kDa |
| GenBank Accession Number | BC093698 |
| Gene Symbol | CD28 |
| Gene ID (NCBI) | 940 |
| ENSEMBL Gene ID | ENSG00000178562 |
| RRID | AB_3673552 |
| Conjugate | CoraLite®594 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm |
| Excitation Laser | Yellow-Green Laser (561 nm) |
| Purification Method | Protein A purification |
| UNIPROT ID | P10747 |
| Storage Buffer | PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. |
| FC protocol for CL594 CD28 antibody CL594-98032 | Download protocol |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240354D2 |
| Conjugation | CoraLite®594 |
CD28 (T-cell-specific surface glycoprotein CD28), also known as T44 and Tp44, is a 44 kD disulfide-linked homodimeric type I glycoprotein (PMID: 2162180). It is a member of the immunoglobulin superfamily and is expressed on most T lineage cells, NK cell subsets, and plasma cells (PMID: 2162180, 8386518). CD28 may affect in vivo immune responses by functioning both as a cell adhesion molecule linking B and T lymphocytes and as the surface component of a novel signal transduction pathway (PMID: 2162180, 3021470). CD28 binds both CD80 and CD86 with a highly conserved motif MYPPY in the CDR3-like loop (PMID: 15696168, 7964482). CD28 is considered a major co-stimulatory molecule, inducing T lymphocyte activation and IL-2 synthesis, and preventing cell death (PMID: 1348520). Protocols Product Specific Protocols FC protocol for CL594 CD28 antibody CL594-98032 Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents