FDFT1 Polyclonal antibody 13128-1-AP proteintech
$149.00
In stock
SKU
13128-1-AP
| Catalog Number | 13128-1-AP |
| Synonyms | DGPT, EC:2.5.1.21, ERG9, Farnesyl-diphosphate farnesyltransferase, Farnesyl-diphosphate farnesyltransferase 1 |
| Host | Rabbit |
| Reactivity | human and More (1) |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HepG2 cells, T-47D cells |
| Tested Applications — Positive IP detected in | COLO 320 cells |
| Tested Applications — Positive IHC detected in | human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HepG2 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:4000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive WB detected in | HepG2 cells, T-47D cells |
| Positive IP detected in | COLO 320 cells |
| Positive IHC detected in | human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag3743 Product name: Recombinant human SQS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-358 aa of BC029641 Sequence: MEFVKCLGHPEEFYNLVRFRIGGKRKVMPKMDQDSLSSSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICRRMGIGMAEFLDKHVTSEQEWDKYCHYVAGLVGIGLSRLFSASEFEDPLVGEDTERANSMGLFLQKTNIIRDYLEDQQGGREFWPQEVWSRYVKKLGDFAKPENIDLAVQCLNELITNALHHIPDVITYLSRLRNQSVFNFCAIPQVMAIATLAACYNNQQVFKGAVKIRKGQAVTLMMDATNMPAVKAIIYQYMEEIYHRIPDSDPSSSK Predict reactive species |
| Full Name | farnesyl-diphosphate farnesyltransferase 1 |
| Calculated Molecular Weight | 417 aa, 48 kDa |
| Observed Molecular Weight | 48 kDa |
| GenBank Accession Number | BC029641 |
| Gene Symbol | FDFT1 |
| Gene ID (NCBI) | 2222 |
| RRID | AB_2294094 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P37268 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for FDFT1 antibody 13128-1-AP | Download protocol |
| IHC protocol for FDFT1 antibody 13128-1-AP | Download protocol |
| IP protocol for FDFT1 antibody 13128-1-AP | Download protocol |
| WB protocol for FDFT1 antibody 13128-1-AP | Download protocol |
| mouse,human | WB Nature Feeding induces cholesterol biosynthesis via the mTORC1-USP20-HMGCR axis. Authors - Xiao-Yi Lu View Article |
| mouse | WB Neuron Astrocytic ApoE reprograms neuronal cholesterol metabolism and histone-acetylation-mediated memory. Authors - Xiaohui Li View Article |
| human | WB Phytomedicine Hibiscus syriacus L. cultivated in callus culture exerts cytotoxicity in colorectal cancer via Notch signaling-mediated cholesterol biosynthesis suppression. Authors - Xing Yue Xu View Article |
| Citations | 34 |
| Dilutions | WB : 1:1000-1:4000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:50-1:500 IF/ICC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Farnesyl-diphosphate farnesyltransferase 1 (FDFT1), also known as SQS, is a gene that encodes the membrane-associated enzyme squalene synthase, which is the first specific enzyme in cholesterol biosynthesis. FDFT1 is highly expressed in liver, lung, prostate, breast, ovary, bladder, cervix, thyroid, and esophageal cancers, while in colorectal, colon, testicular, uterine, pancreas, and kidney tumors, its expression is downregulated (PMID: 35093030). FDFT1 is a key downstream target of the fasting response and may be involved in CRC cell glucose metabolism (PMID: 32313017). Protocols Product Specific Protocols IF protocol for FDFT1 antibody 13128-1-AP Download protocol IHC protocol for FDFT1 antibody 13128-1-AP Download protocol IP protocol for FDFT1 antibody 13128-1-AP Download protocol WB protocol for FDFT1 antibody 13128-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Feeding induces cholesterol biosynthesis via the mTORC1-USP20-HMGCR axis.
Journal: Nature | Authors: Xiao-Yi Lu | Species: mouse,human | Application: WB - Functional Genomics Identifies Metabolic Vulnerabilities in Pancreatic Cancer.
Journal: Cell Metab | Authors: Douglas E Biancur KD Validated | Species: mouse | Application: WB - Endothelial Cells Mediated by STING Regulate Oligodendrogenesis and Myelination During Brain Development
Journal: Adv Sci (Weinh) | Authors: Wenwen Wang | Species: mouse | Application: WB - Astrocytic ApoE reprograms neuronal cholesterol metabolism and histone-acetylation-mediated memory.
Journal: Neuron | Authors: Xiaohui Li | Species: mouse | Application: WB - Caffeine supplementation and FOXM1 inhibition enhance the antitumor effect of statins in neuroblastoma
Journal: Cancer Res | Authors: Gia-Buu Tran KD Validated | Species: human | Application: WB - Hibiscus syriacus L. cultivated in callus culture exerts cytotoxicity in colorectal cancer via Notch signaling-mediated cholesterol biosynthesis suppression.
Journal: Phytomedicine | Authors: Xing Yue Xu | Species: human | Application: WB - A chemical biology screen identifies a vulnerability of neuroendocrine cancer cells to SQLE inhibition.
Journal: Nat Commun | Authors: Christopher E Mahoney | Species: human | Application: WB - Astrocytic ApoE reprograms neuronal cholesterol metabolism and histone-acetylation-mediated memory.
Journal: Neuron | Authors: Xiaohui Li | Species: mouse | Application: WB - Proteomic profiling reveals novel insights into hypercortisolism adrenal adenomas.
Journal: Metabolism | Authors: Xuyang Shi - mTOR inhibition reprograms cellular lipid homeostasis by inducing alternative lipid uptake and promoting cholesterol transport.
Journal: Mol Cell | Authors: Sejeong Shin | Species: human | Application: WB - A Super-Enhancer-Driven Transcriptional Regulatory Circuit Underlying Abiraterone Resistance in Castration-Resistant Prostate Cancer
Journal: Adv Sci (Weinh) | Authors: Liling Jiang | Species: human | Application: WB - Endothelial Cells Mediated by STING Regulate Oligodendrogenesis and Myelination During Brain Development
Journal: Adv Sci (Weinh) | Authors: Wenwen Wang | Species: mouse | Application: WB - MiR-122-5p regulates the mevalonate pathway by targeting p53 in non-small cell lung cancer
Journal: Cell Death Dis | Authors: Yu-Kun Zheng | Species: human | Application: WB,IHC - SQLE promotes pancreatic cancer growth by attenuating ER stress and activating lipid rafts-regulated Src/PI3K/Akt signaling pathway
Journal: Cell Death Dis | Authors: Ruiyuan Xu | Species: human | Application: WB - Co-administration of berberine and evodiamine: Mitigating evodiamine-induced hepatotoxicity and potentiating colitis treatment
Journal: Phytomedicine | Authors: Xiaoyu Tao | Application: WB - Hibiscus syriacus L. cultivated in callus culture exerts cytotoxicity in colorectal cancer via Notch signaling-mediated cholesterol biosynthesis suppression.
Journal: Phytomedicine | Authors: Xing Yue Xu | Species: human | Application: WB - RON-augmented cholesterol biosynthesis in breast cancer metastatic progression and recurrence
Journal: Oncogene | Authors: Brian G Hunt | Species: human | Application: WB - Fatty Acid Esterification of Octacosanol Attenuates Triglyceride and Cholesterol Synthesis in Mice
Journal: J Agric Food Chem | Authors: Sudthida Kamchonemenukool | Species: mouse | Application: WB - DHODH Blockade Induces Ferroptosis in Neuroblastoma by Modulating the Mevalonate Pathway
Journal: Mol Cell Proteomics | Authors: Jui-Chia Shir | Species: human | Application: WB - THEM6 modulates carboplatin sensitivity by regulating ferroptosis through FDFT1 in triple-negative breast cancer
Journal: Breast Cancer Res | Authors: Yuexiang Zeng | Species: human | Application: WB - Squalene synthase predicts poor prognosis in stage I‐III colon adenocarcinoma and synergizes squalene epoxidase to promote tumor progression
Journal: Cancer Sci | Authors: Huihong Jiang | Species: human | Application: WB,IHC - The compound LY295427 antagonizes 25-hydroxycholesterol through binding to INSIG.
Journal: J Lipid Res | Authors: Xing-Yan Wen | Species: human | Application: WB - Ginsenoside 20(S)-Rg3 upregulates SQLE to reprogram cholesterol metabolism of ovarian cancer cells
Journal: iScience | Authors: Fang He - Low temperature rather than hypoxia drives cholesterol synthesis and oxygen consumption in plateau zokors.
Journal: iScience | Authors: Qingfei Hu - Suppression of SREBP by a transmembrane protein mutated in cardiomyopathy.
Journal: J Biol Chem | Authors: Yasushi Takemoto | Species: human | Application: WB - Identification of FDA-approved drugs that increase mevalonate kinase in hyper IgD syndrome
Journal: J Inherit Metab Dis | Authors: Frouwkje A Politiek | Species: human | Application: WB - Schwann Cells Accelerate Osteogenesis via the Mif/CD74/FOXO1 Signaling Pathway In Vitro.
Journal: Stem Cells Int | Authors: Jun-Qin Li | Species: mouse | Application: WB - Periodontal ligament fibroblasts utilize isoprenoid intermediate farnesyl diphosphate for maintaining osteo/cementogenic differentiation abilities
Journal: J Dent Sci | Authors: Xiuting Wang | Species: Mouse | Application: IHC - 20(S)-Rg3 upregulates FDFT1 via reducing miR-4425 to inhibit ovarian cancer progression.
Journal: Arch Biochem Biophys | Authors: Jiaojiao Lu | Species: human | Application: WB,IHC - Arginase 2 regulates cholesterol biosynthesis in endothelial cells.
Journal: Exp Cell Res | Authors: Yifang Zhang | Species: human | Application: WB - Arginase 2 regulates cholesterol biosynthesis in endothelial cells.
Journal: Exp Cell Res | Authors: Yifang Zhang | Species: human | Application: WB - Loss of hepaCAM inhibits cholesterol biosynthesis and impairs learning and memory in mice.
Journal: Brain Res | Authors: Ziyu Qiu - PKMYT1 knockdown inhibits cholesterol biosynthesis and promotes the drug sensitivity of triple-negative breast cancer cells to atorvastatin
Journal: PeerJ | Authors: Wei Gao | Species: human | Application: WB - Proteomics of stress-induced cardiomyopathy: insights from differential expression, protein interaction networks, and functional pathway enrichment in an isoproterenol-induced TTC mouse model
Journal: PeerJ | Authors: Liuyang Tian | Species: mouse | Application: WB
Reviews
Write Your Own Review