CoraLite® Plus 488-conjugated CD31 Monoclonal antibody CL488-66065 proteintech
$479.00
In stock
SKU
CL488-66065
| Catalog Number | CL488-66065 |
| Synonyms | 3F8E2, EndoCAM, GPIIA, GPIIA', PECA1 |
| Host | Mouse |
| Reactivity | human and More (1) |
| Reactivity | human, rat |
| Form | Liquid |
| Formulation | PBS, Proclin300, BSA, Glycerol |
| Applications | IF/ICC, IF-P |
| Host / Isotype | Mouse / IgG1 |
| Tested Applications — Positive IF-P detected in | human tonsillitis tissue, human colon cancer tissue, human placenta tissue |
| Tested Applications — Positive IF/ICC detected in | Lymphatic endothelial cells cells, HUVEC cells |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive IF-P detected in | human tonsillitis tissue, human colon cancer tissue, human placenta tissue |
| Positive IF/ICC detected in | Lymphatic endothelial cells cells, HUVEC cells |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | human |
| Cited Reactivity | human, rat |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag1787 Product name: Recombinant human CD31 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 428-738 aa of BC022512 Sequence: EVRCESISGTLPISYQLLKTSKVLENSTKNSNDPAVFKDNPTEDVEYQCVADNCHSHAKMLSEVLRVKVIAPVDEVQISILSSKVVESGEDIVLQCAVNEGSGPITYKFYREKEGKPFYQMTSNATQAFWTKQKANKEQEGEYYCTAFNRANHASSVPRSKILTVRVILAPWKKGLIAVVIIGVIIALLIIAAKCYFLRKAKAKQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVGNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT Predict reactive species |
| Full Name | platelet/endothelial cell adhesion molecule |
| Calculated Molecular Weight | 83 kDa |
| GenBank Accession Number | BC022512 |
| Gene Symbol | CD31 |
| Gene ID (NCBI) | 5175 |
| ENSEMBL Gene ID | ENSG00000261371 |
| RRID | AB_2883247 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Purification Method | Protein A purification |
| UNIPROT ID | P16284 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. |
| IF protocol for CL Plus 488 CD31 antibody CL488-66065 | Download protocol |
| human | IF Signal Transduct Target Ther Anlotinib combined with neoadjuvant chemotherapy for HR+/HER2- breast cancer (ACNTBC): a prospective, single-arm, single-center phase II clinical study with real-world validation. Authors - Jiajun Ding View Article |
| rat | IF Mol Med Rep Swimming training promotes angiogenesis of endothelial progenitor cells by upregulating IGF1 expression and activating the PI3K/AKT pathway in type 2 diabetic rats Authors - Lan Li View Article |
| Citations | 4 |
| Dilutions | IF-P : 1:200-1:800 IF/ICC : 1:50-1:500 |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 3F8E2 |
| Conjugation | CoraLite® Plus 488 |
Platelet endothelial cell adhesion molecule-1 (PECAM-1, CD31) is a member of the immunoglobulin gene superfamily of cell adhesion molecules. CD31 is a transmembrane glycoprotein that is highly expressed on the surface of the endothelium, making up a large portion of its intracellular junctions. PECAM-1 is also present on the surface of hematopoietic cells and immune cells including platelets, monocytes, neutrophils, natural killer cells, megakaryocytes and some types of T-cell (PMID: 9011572). As well as its role in cell-cell adhesion, PECAM-1 functions as a signaling receptor, and is involved in important physiological events such as nitric oxide production, regulation of T-cell immunity and tolerance, leukocyte transendothelial migration and inflammation and angiogenesis (PMID: 21183735; 20978210; 17872453; 20634489). This antibody is conjugated with CL488, Ex/Em 488 nm/515 nm. Protocols Product Specific Protocols IF protocol for CL Plus 488 CD31 antibody CL488-66065 Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Irisin links Claudin-5 preservation and Mfn2-mediated mitochondrial dynamics to resist doxorubicin-induced cardiac endothelial damage
Journal: Biochem Biophys Res Commun | Authors: Jun He | Species: human | Application: IF - Exosomal PGAM1 promotes prostate cancer angiogenesis and metastasis by interacting with ACTG1
Journal: Cell Death Dis | Authors: Jun-Qi Luo | Species: human | Application: IF - Swimming training promotes angiogenesis of endothelial progenitor cells by upregulating IGF1 expression and activating the PI3K/AKT pathway in type 2 diabetic rats
Journal: Mol Med Rep | Authors: Lan Li | Species: rat | Application: IF - Anlotinib combined with neoadjuvant chemotherapy for HR+/HER2- breast cancer (ACNTBC): a prospective, single-arm, single-center phase II clinical study with real-world validation.
Journal: Signal Transduct Target Ther | Authors: Jiajun Ding | Species: human | Application: IF
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
