MRPS22 Polyclonal antibody 10984-1-AP proteintech
$149.00
In stock
SKU
10984-1-AP
| Catalog Number | 10984-1-AP |
| Synonyms | C3orf5, COXPD5, GIBT, GK002, MRP S22 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP, ELISA |
| Applications | WB, IHC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | Jurkat cells, THP-1 cells, mouse liver tissue, rat liver tissue |
| Tested Applications — Positive IP detected in | Jurkat cells |
| Tested Applications — Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Positive WB detected in | Jurkat cells, THP-1 cells, mouse liver tissue, rat liver tissue |
| Positive IP detected in | Jurkat cells |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag1421 Product name: Recombinant human MRPS22 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-360 aa of BC009296 Sequence: MAPLGTTVLLWSLLRSSPGVERVCFRARIQPWHGGLLQPLPCSFEMGLPRRRFSSEAAESGSPETKKPTFMDEEVQSILTKMTGLNLQKTFKPAIQELKPPTYKLMTQAQLEEATRQAVEAAKVRLKMPPVLEERVPINDVLAEDKILEGTETTKYVFTDISYSIPHRERFIVVREPSGTLRKASWEERDRMIQVYFPKEGRKILTPIIFKEENLRTMYSQDRHVDVLNLCFAQFEPDSTEYIKVHHKTYEDIDKRGKYDLLRSTRYFGGMVWYFVNNKKIDGLLIDQIQRDLIDDATNLVQLYHVLHPDGQSAQGAKDQAAEGINLIKVFAKTEAQKGAYIELTLQTYQEALSRHSAAS Predict reactive species |
| Full Name | mitochondrial ribosomal protein S22 |
| Calculated Molecular Weight | 41 kDa |
| Observed Molecular Weight | 38 kDa |
| GenBank Accession Number | BC009296 |
| Gene Symbol | MRPS22 |
| Gene ID (NCBI) | 56945 |
| RRID | AB_2146488 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P82650 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for MRPS22 antibody 10984-1-AP | Download protocol |
| IP protocol for MRPS22 antibody 10984-1-AP | Download protocol |
| WB protocol for MRPS22 antibody 10984-1-AP | Download protocol |
| human | WB Nucleic Acids Res Replication factors transiently associate with mtDNA at the mitochondrial inner membrane to facilitate replication. Authors - Nina Rajala View Article |
| mouse,human | WB Nucleic Acids Res p32/gC1qR is indispensable for fetal development and mitochondrial translation: importance of its RNA-binding ability. Authors - Yagi Mikako M View Article |
| Citations | 27 |
| Dilutions | WB : 1:500-1:2000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:20-1:200 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
MRPS22, also named as C3orf5, RPMS22 and S22mt, is a component of the mitochondrial ribosome small subunit (28S) which comprises a 12S rRNA and about 30 distinct proteins. Defects in MRPS22 are the cause of combined oxidative phosphorylation deficiency type 5 (COXPD5). MRPS22 is a 360-amino-acid protein that has been found in a limited number of species, having no ortholog in fungi or prokaryotes. The exact location of MRPS22 in the three dimensional structure of the ribosome and its exact function are currently unknown. Recently, a MRPS22 defect was shown to strongly hamper assembly of the small ribosomal subunit, whereas assembly of the large subunit and part of the small subunit were only mildly affected.(PMID:21189481) Protocols Product Specific Protocols IHC protocol for MRPS22 antibody 10984-1-AP Download protocol IP protocol for MRPS22 antibody 10984-1-AP Download protocol WB protocol for MRPS22 antibody 10984-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- The mitochondrial RNA-binding protein GRSF1 localizes to RNA granules and is required for posttranscriptional mitochondrial gene expression.
Journal: Cell Metab | Authors: Antonicka Hana H | Species: human | Application: WB - The Human Mitochondrial DEAD-Box Protein DDX28 Resides in RNA Granules and Functions in Mitoribosome Assembly.
Journal: Cell Rep | Authors: Ya-Ting Tu | Species: human | Application: WB - Mutations in the UQCC1-Interacting Protein, UQCC2, Cause Human Complex III Deficiency Associated with Perturbed Cytochrome b Protein Expression.
Journal: PLoS Genet | Authors: Elena J Tucker | Species: human | Application: WB - p32/gC1qR is indispensable for fetal development and mitochondrial translation: importance of its RNA-binding ability.
Journal: Nucleic Acids Res | Authors: Yagi Mikako M | Species: mouse,human | Application: WB - C7orf30 specifically associates with the large subunit of the mitochondrial ribosome and is involved in translation.
Journal: Nucleic Acids Res | Authors: Wanschers Bas F J BF | Species: human | Application: WB - Replication factors transiently associate with mtDNA at the mitochondrial inner membrane to facilitate replication.
Journal: Nucleic Acids Res | Authors: Nina Rajala | Species: human | Application: WB - Mitochondrial RNA granules are critically dependent on mtDNA replication factors Twinkle and mtSSB.
Journal: Nucleic Acids Res | Authors: Fenna Hensen | Species: human | Application: WB - A roadmap for ribosome assembly in human mitochondria
Journal: Nat Struct Mol Biol | Authors: Elena Lavdovskaia | Species: human | Application: WB - The Human Mitochondrial DEAD-Box Protein DDX28 Resides in RNA Granules and Functions in Mitoribosome Assembly.
Journal: Cell Rep | Authors: Ya-Ting Tu | Species: human | Application: WB - Homeostatic control of nuclear-encoded mitochondrial gene expression by the histone variant H2A.Z is essential for neuronal survival.
Journal: Cell Rep | Authors: Christopher Lowden | Species: mouse | Application: WB - Mitochondrial RNA Granules Are Centers for Posttranscriptional RNA Processing and Ribosome Biogenesis.
Journal: Cell Rep | Authors: Hana Antonicka | Species: human | Application: WB - MitoRibo-Tag Mice Provide a Tool for In Vivo Studies of Mitoribosome Composition.
Journal: Cell Rep | Authors: Jakob D Busch | Species: mouse | Application: WB - Quantitative proteomics of patient fibroblasts reveal biomarkers and diagnostic signatures of mitochondrial disease
Journal: JCI Insight | Authors: Sandrina P Correia | Species: human | Application: WB - A pseudouridine synthase module is essential for mitochondrial protein synthesis and cell viability.
Journal: EMBO Rep | Authors: Hana Antonicka | Species: human | Application: WB - Human Mitochondrial DNA-Protein Complexes Attach to a Cholesterol-Rich Membrane Structure.
Journal: Sci Rep | Authors: Joachim M Gerhold | Species: human | Application: WB - Supernumerary proteins of the human mitochondrial ribosomal small subunit are integral for assembly and translation
Journal: iScience | Authors: Taru Hilander | Species: human | Application: WB - Messenger RNA delivery to mitoribosomes - hints from a bacterial toxin.
Journal: FEBS J | Authors: Francesco Bruni | Species: human | Application: WB - Mutations in the UQCC1-Interacting Protein, UQCC2, Cause Human Complex III Deficiency Associated with Perturbed Cytochrome b Protein Expression.
Journal: PLoS Genet | Authors: Elena J Tucker | Species: human | Application: WB - Germ cell-specific deletion of Pex3 reveals essential roles of PEX3-dependent peroxisomes in spermiogenesis
Journal: J Biomed Res | Authors: Yejin Yao | Species: mouse | Application: WB - Mutations in the mitochondrial ribosomal protein MRPS22 lead to primary ovarian insufficiency.
Journal: Hum Mol Genet | Authors: Anlu Chen | Species: human | Application: WB - Suppressive genetic interactions between haploinsufficient mitochondrial genes encoded in the 22q11.2 microdeletion locus define brain and cardiac phenotypes.
Journal: Hum Mol Genet | Authors: Meghan Wynne - MRPS22 variants alter mitochondrial ribosome assembly in patients with leukodystrophy, movement disorder and intellectual impairment.
Journal: Hum Mol Genet | Authors: Ruth I. C. Glasgow | Species: human | Application: WB - The arginine methyltransferase NDUFAF7 is essential for complex I assembly and early vertebrate embryogenesis.
Journal: Hum Mol Genet | Authors: Olga Zurita Rendón | Species: human | Application: WB - A homozygous missense mutation in ERAL1, encoding a mitochondrial rRNA chaperone, causes Perrault syndrome.
Journal: Hum Mol Genet | Authors: Iliana A Chatzispyrou | Species: human | Application: WB - Stomatin-like protein 2 deficiency results in impaired mitochondrial translation.
Journal: PLoS One | Authors: Panagiotis Mitsopoulos | Species: mouse | Application: WB - Suppressive Genetic Interactions Between Haploinsufficient Mitochondrial Genes Encoded in the 22q11.2 Microdeletion Locus Define Brain and Cardiac Phenotypes.
Journal: bioRxiv | Authors: Meghan Wynne | Species: human | Application: WB - Tumor Genotype Dictates Mitochondrial and Immune Vulnerabilities in Liver Cancer
Journal: bioRxiv | Authors: Gokhan Unlu
Reviews
Write Your Own Review