CoraLite® Plus 488-conjugated CD3EAP Recombinant monoclonal antibody CL488-84139-5 proteintech
$479.00
In stock
SKU
CL488-84139-5
| Catalog Number | CL488-84139-5 |
| Synonyms | 241379E2, A34.5, Antisense to ERCC-1 protein, ASE1, ASE-1 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Proclin300, BSA, Glycerol |
| Applications | IF/ICC |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive IF/ICC detected in | A431 cells |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive IF/ICC detected in | A431 cells |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag35074 Product name: Recombinant human CD3EAP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-130 aa of BC038992 Sequence: MEEPQAGDAARFSCPPNFTAKPPASESPRFSLEALTGPDTELWLIQAPADFAPECFNGRHVPLSGSQIVKGKLAGKRHRYRVLSSCPQAGEATLLAPSTEAGGGLTCASAPQGTLRILEGPQQSLSGSPL Predict reactive species |
| Full Name | CD3e molecule, epsilon associated protein |
| Calculated Molecular Weight | 510 aa, 55 kDa |
| Observed Molecular Weight | 80-90 kDa |
| GenBank Accession Number | BC038992 |
| Gene Symbol | CD3EAP |
| Gene ID (NCBI) | 10849 |
| RRID | AB_3747487 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Purification Method | Protein A purification |
| UNIPROT ID | O15446 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. |
| IF protocol for CL Plus 488 CD3EAP antibody CL488-84139-5 | Download protocol |
| Citations | - |
| Dilutions | IF/ICC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 241379E2 |
| Conjugation | CoraLite® Plus 488 |
Human RNA polymerase I (Pol I)-specific subunit, previously identified as ASE-1 and as CD3ɛ-associated signal transducer (CAST), CD3EAP is a 55 kDa nucleolar autoantigen that has an apparent molecular mass of 90 kDa (PMID: 11199923). CD3EAP/hPAF49 contains a single tyrosine residue at position 82 (Tyr82), which is phosphorylated upon stimulation of the T-cell receptor. Western blot analysis detected CD3EAP at an apparent molecular mass of ~80-90 kDa. Protocols Product Specific Protocols IF protocol for CL Plus 488 CD3EAP antibody CL488-84139-5 Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
