Lamin B1 Monoclonal antibody 66095-1-Ig proteintech
$189.00
In stock
SKU
66095-1-Ig
| Catalog Number | 66095-1-Ig ab16048 13435 SAB1306342 |
| Synonyms | LMNB1, 3C10G12, laminB1, Lamin-B1, LMN2 |
| Host | Mouse Rabbit Rabbit Rabbit |
| Reactivity | human, mouse, rat and More (6) |
| Reactivity | human, mouse, rat, rabbit, canine, monkey, chicken, zebrafish, hamster Mouse, Rat, Human Human, Mouse, Rat human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IF-P, FC (Intra), IP, CoIP, ELISA |
| Applications | WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA ICC/IF,WB,IHC-P, WB,IP, IHC, WB |
| Host / Isotype | Mouse / IgG1 |
| Tested Applications — Positive WB detected in | NCI-H1299 cells, multi-cells/tissue, HeLa cells, HepG2 cells, HEK-293 cells, Jurkat cells, K-562 cells, PC-12 cells, NIH/3T3 cells, 4T1cells |
| Tested Applications — Positive IP detected in | HeLa cells |
| Tested Applications — Positive IHC detected in | human pancreas cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF-P detected in | mouse eye tissue |
| Tested Applications — Positive IF/ICC detected in | HepG2 cells, HeLa cells |
| Tested Applications — Positive FC (Intra) detected in | HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:20000-1:100000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| Recommended Dilutions — Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Positive WB detected in | NCI-H1299 cells, multi-cells/tissue, HeLa cells, HepG2 cells, HEK-293 cells, Jurkat cells, K-562 cells, PC-12 cells, NIH/3T3 cells, 4T1cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human pancreas cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse eye tissue |
| Positive IF/ICC detected in | HepG2 cells, HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
| Western Blot (WB) | WB : 1:20000-1:100000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, rabbit, canine, monkey, chicken, zebrafish, hamster |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag20522 Product name: Recombinant human Lamin B1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 237-587 aa of BC012295 Sequence: EYEYKLAQALHEMREQHDAQVRLYKEELEQTYHAKLENARLSSEMNTSTVNSAREELMESRMRIESLSSQLSNLQKESRACLERIQELEDLLAKEKDNSRRMLTDKEREMAEIRDQMQQQLNDYEQLLDVKLALDMEISAYRKLLQGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM Predict reactive species |
| Full Name | lamin B1 |
| Calculated Molecular Weight | 66 kDa |
| Observed Molecular Weight | 66-70 kDa |
| GenBank Accession Number | BC012295 |
| Gene Symbol | Lamin B1 |
| Gene ID (NCBI) | 4001 |
| ENSEMBL Gene ID | ENSG00000113368 |
| RRID | AB_11232208 |
| Conjugate | Unconjugated |
| Purification Method | Protein G purification |
| UNIPROT ID | P20700 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| FC protocol for Lamin B1 antibody 66095-1-Ig | Download protocol |
| IF protocol for Lamin B1 antibody 66095-1-Ig | Download protocol |
| IHC protocol for Lamin B1 antibody 66095-1-Ig | Download protocol |
| IP protocol for Lamin B1 antibody 66095-1-Ig | Download protocol |
| WB protocol for Lamin B1 antibody 66095-1-Ig | Download protocol |
| mouse | WB Mol Cancer CBFA2T2: a novel H3K27 reader regulating metabolism and tumor growth. Authors - Shengfei He View Article |
| human | WB Signal Transduct Target Ther Gut dysbiosis conveys psychological stress to activate LRP5/β-catenin pathway promoting cancer stemness Authors - Bai Cui View Article |
| Roy (Verified Customer) (09-16-2026) | Great antibody used for Western-Blot with 10µg of protein extracts and an 1h incubation at room temperature! Applications: Western Blot Primary Antibody Dilution: 1/2000 Cell Tissue Type: HeLa, K562 |
| Mariana (Verified Customer) (07-20-2026) | The antibody worked very well. Applications: Immunofluorescence Primary Antibody Dilution: 1:1000 Cell Tissue Type: U2OS cells |
| Nurit (Verified Customer) (02-16-2026) | We used this antibody for western blotting of human iPSC-derived astrocytes (Rett syndrome patient) and it worked great. In the image, Lamin B1 is in green (red is unrelated p62) Applications: Western Blot, Cell culture Cell Tissue Type: Astrocytes derived from human iPSCs Lamin B1 Antibody Western Blot,Cell culture validation ( dilution) in Astrocytes derived from human iPSCs (Cat no:66095-1-Ig) |
| Echo (Verified Customer) (10-03-2024) | Quality great Applications: Western Blot Primary Antibody Dilution: 1:5000 Cell Tissue Type: HEK293T Lamin B1 Antibody Western Blot validation (1:5000 dilution) in HEK293T (Cat no:66095-1-Ig) |
| PK (Verified Customer) (08-14-2024) | Excellent Applications: Western Blot Primary Antibody Dilution: 1000 Cell Tissue Type: AC16 Lamin B1 Antibody Western Blot validation (1000 dilution) in AC16 (Cat no:66095-1-Ig) |
| S (Verified Customer) (12-12-2022) | Applications: Western Blot Primary Antibody Dilution: 1000 Cell Tissue Type: LUNG Fibroblast Lamin B1 Antibody Western Blot validation (1000 dilution) in LUNG Fibroblast (Cat no:66095-1-Ig) |
| WEI (Verified Customer) (03-08-2022) | Specfic bands around predicted size with higher non-specific bands Applications: Western Blot Primary Antibody Dilution: 1:1000 Cell Tissue Type: Mouse Heart |
| P. (Verified Customer) (05-15-2021) | Good antibody! Applications: Western Blot Cell Tissue Type: H9C2 Lamin B1 Antibody Western Blot validation ( dilution) in H9C2 (Cat no:66095-1-Ig) |
| Eiko (Verified Customer) (11-18-2020) | Used RIPA buffer for western sample preparation, and 5% Skim milk TBS-T was used for blocking and antibody dilution.Since I could see clear lamin B1 signal, I am happy to use this antibody as one of my internal controls. Applications: Western Blot Primary Antibody Dilution: 1:2000 (can be more diluted) Cell Tissue Type: hTERT-RPE1 |
| Tom (Verified Customer) (10-09-2020) | I observed a discrete ~70kDa Lamin B1 band using this antibody. Applications: Western Blot Primary Antibody Dilution: 1:1000 |
| Yuan (Verified Customer) (12-13-2019) | Did staining for human A549 cell.The Lamin B antibody had high background in nucleus. Please see attached image. Applications: Immunofluorescence, Primary Antibody Dilution: 1:250 Cell Tissue Type: Human A549 cell Lamin B1 Antibody Immunofluorescence, validation (1:250 dilution) in Human A549 cell (Cat no:66095-1-Ig) |
| Shubham (Verified Customer) (03-14-2019) | good Applications: Western Blot, Cell Tissue Type: AC16 Lamin B1 Antibody Western Blot, validation ( dilution) in AC16 (Cat no:66095-1-Ig) |
| Citations | 585 View Lamin B1 Polyclonal Antibody 12987-1-AP (1766 citations) 858 234 5 |
| Dilutions | WB : 1:20000-1:100000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:500-1:2000 IF-P : 1:200-1:800 IF/ICC : 1:250-1:1000 FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension ICC/IF:Use a concentration of 0.1 μg/ml. WB:Use a concentration of 0.1 μg/ml. IHC-P:Use a concentration of 0.1 - 1 μg/ml. Western Blotting1:1000Immunoprecipitation1:50 immunohistochemistry: 1:50-1:100western blot: 1:1000 |
| Isotype | IgG1 IgG IgG Not stated on vendor's website |
| Clonality | Monoclonal Polyclonal Monoclonal Polyclonal |
| Clone Number | 3C10G12 - D9V6H - |
| Conjugation | Unconjugated Unconjugated Unconjugated Unconjugated |
Lamins are components of the nuclear lamina, a fibrous layer on the nucleoplasmic side of the inner nuclear membrane, which is thought to provide a framework for the nuclear envelope and may also interact with chromatin. The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Vertebrate lamins consist of two types, A and B. This gene encodes one of the two B type proteins, B1. This protein is not suitable for samples where the nuclear envelope has been removed. Protocols Product Specific Protocols FC protocol for Lamin B1 antibody 66095-1-Ig Download protocol IF protocol for Lamin B1 antibody 66095-1-Ig Download protocol IHC protocol for Lamin B1 antibody 66095-1-Ig Download protocol IP protocol for Lamin B1 antibody 66095-1-Ig Download protocol WB protocol for Lamin B1 antibody 66095-1-Ig Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Novel nuclear RNA export factor 1 adaptor drives tumor growth by increasing proliferation-stimulatory mRNA export
Journal: Signal Transduct Target Ther | Authors: Jin-Yu Liu | Application: IF - PUMA facilitates EMI1-promoted cytoplasmic Rad51 ubiquitination and inhibits DNA repair in stem and progenitor cells.
Journal: Signal Transduct Target Ther | Authors: Jin Wook Kang | Species: mouse | Application: WB - Gut dysbiosis conveys psychological stress to activate LRP5/β-catenin pathway promoting cancer stemness
Journal: Signal Transduct Target Ther | Authors: Bai Cui | Species: human | Application: WB - Cooperative sensing of mitochondrial DNA by ZBP1 and cGAS promotes cardiotoxicity
Journal: Cell | Authors: Yuanjiu Lei | Species: mouse | Application: WB - CBFA2T2: a novel H3K27 reader regulating metabolism and tumor growth.
Journal: Mol Cancer | Authors: Shengfei He | Species: mouse | Application: WB - OGDHL silencing promotes hepatocellular carcinoma by reprogramming glutamine metabolism.
Journal: J Hepatol | Authors: Weiqi Dai
Reviews
Write Your Own Review