Mouse CD47 Recombinant monoclonal antibody, PBS Only 85958-1-PBS proteintech
$699.00
In stock
SKU
85958-1-PBS
| Catalog Number | 85958-1-PBS |
| Synonyms | IAP, Integrin-associated protein, Leukocyte surface antigen CD47 |
| Host | Rabbit |
| Reactivity | mouse |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | WB, IF/ICC, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | mouse |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg1394 Product name: Recombinant Mouse CD47 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 19-140 aa of NP_001355344.1 Sequence: QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEK Predict reactive species |
| Full Name | CD47 antigen (Rh-related antigen, integrin-associated signal transducer) |
| Calculated Molecular Weight | 33 kDa |
| Observed Molecular Weight | 45-55 kDa |
| GenBank Accession Number | NP_001355344.1 |
| Gene Symbol | Cd47 |
| Gene ID (NCBI) | 16423 |
| RRID | AB_3744505 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q61735-1 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 242850C4 |
| Conjugation | Unconjugated |
CD47, also known as integrin-associated protein (IAP), is a member of the immunoglobulin superfamily containing a five-pass transmembrane attachment. CD47 is heavily glycosylated and widely expressed by hematopoietic and nonhematopoietic cells. CD47 interacts with several membrane integrins and also acts as a receptor for thrombospondin (THBS1). It is involved in a range of cellular processes, including apoptosis, proliferation, adhesion, and migration. CD47 also functions as a ligand for signal regulatory protein-α (SIRPα). Upon binding CD47, SIRPα initiates a signaling cascade that results in the inhibition of phagocytosis.