CoraLite® Plus 647 Anti-Human CD47 Rabbit Recombinant Antibody CL647-98131 proteintech
$144.00
In stock
SKU
CL647-98131
| Catalog Number | CL647-98131 |
| Synonyms | 240997D8, CD47 molecule, IAP, Integrin associated protein, Integrin-associated protein |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, BSA |
| Applications | FC |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive FC detected in | human PBMCs |
| Positive FC detected in | human PBMCs |
| Flow Cytometry (FC) | FC : 5 ul per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg31499 Product name: Recombinant Human CD47 protein (Myc Tag, His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: Myc & 6*His Domain: 19-139 aa of BC010016 Sequence: QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVCVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP Predict reactive species |
| Full Name | CD47 molecule |
| Calculated Molecular Weight | 323 aa, 35 kDa |
| GenBank Accession Number | BC010016 |
| Gene Symbol | CD47 |
| Gene ID (NCBI) | 961 |
| RRID | AB_3748748 |
| Conjugate | CoraLite® Plus 647 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 654 nm / 674 nm |
| Excitation Laser | Red Laser (633 nm) |
| Purification Method | Protein A purification |
| UNIPROT ID | Q08722 |
| Storage Buffer | PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. |
| FC protocol for CL Plus 647 CD47 antibody CL647-98131 | Download protocol |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240997D8 |
| Conjugation | CoraLite® Plus 647 |
CD47, also known as integrin-associated protein (IAP), is a member of the immunoglobulin superfamily containing a five-pass transmembrane attachment. CD47 is heavily glycosylated and widely expressed by hematopoietic and nonhematopoietic cells. CD47 interacts with several membrane integrins and also acts as a receptor for thrombospondin (THBS1). It is involved in a range of cellular processes, including apoptosis, proliferation, adhesion, and migration. CD47 also functions as a ligand for signal regulatory protein-α (SIRPα). Upon binding CD47, SIRPα initiates a signaling cascade that results in the inhibition of phagocytosis. Protocols Product Specific Protocols FC protocol for CL Plus 647 CD47 antibody CL647-98131 Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
