IL-1 beta Monoclonal antibody 66737-1-Ig proteintech
$149.00
In stock
SKU
66737-1-Ig
| Catalog Number | 66737-1-Ig |
| Synonyms | 2A1B4, Catabolin, IL 1, IL 1 beta, IL1 beta |
| Host | Mouse |
| Reactivity | human and More (2) |
| Reactivity | human, rabbit, bovine |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP, ELISA, Cell treatment |
| Applications | WB, IHC, IF/ICC, ELISA |
| Host / Isotype | Mouse / IgG1 |
| Tested Applications — Positive WB detected in | THP-1 cells, A431 cells, U-87 MG cells |
| Tested Applications — Positive IHC detected in | human lung cancer tissue, human skin cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | LPS treated THP-1 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:1000-1:4000 |
| Positive WB detected in | THP-1 cells, A431 cells, U-87 MG cells |
| Positive IHC detected in | human lung cancer tissue, human skin cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | LPS treated THP-1 cells |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:1000-1:4000 |
| Tested Reactivity | human |
| Cited Reactivity | human, rabbit, bovine |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag26030 Product name: Recombinant human IL-1B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 117-269 aa of BC008678 Sequence: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS Predict reactive species |
| Full Name | interleukin 1, beta |
| Calculated Molecular Weight | 269 aa, 31 kDa |
| Observed Molecular Weight | 35 kDa |
| GenBank Accession Number | BC008678 |
| Gene Symbol | IL1B |
| Gene ID (NCBI) | 3553 |
| ENSEMBL Gene ID | ENSG00000125538 |
| RRID | AB_2882087 |
| Conjugate | Unconjugated |
| Purification Method | Protein G purification |
| UNIPROT ID | P01584 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for IL-1 beta antibody 66737-1-Ig | Download protocol |
| IHC protocol for IL-1 beta antibody 66737-1-Ig | Download protocol |
| WB protocol for IL-1 beta antibody 66737-1-Ig | Download protocol |
| human | WB Cell Metab Lighting up arginine metabolism reveals its functional diversity in physiology and pathology Authors - Rui Li View Article |
| Citations | 134 |
| Dilutions | WB : 1:5000-1:50000 IHC : 1:50-1:500 IF/ICC : 1:1000-1:4000 |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 2A1B4 |
| Conjugation | Unconjugated |
Interleukin-1 is a pro-inflammatory cytokine with multiple biological effects. The IL-1 gene family encodes three proteins: IL-1α, IL-1β and their naturally occurring inhibitor Il-1RN. IL-1 Beta(IL-1β), mainly produced by blood monocytes and tissue macrophages, has been implicated in mediating both acute and chronic inflammation. IL-1β is known to be involved in a variety of cellular activities, including cell proliferation, differentiation and apoptosis. IL-1β is emerging as a key mediator of carcinogenesis that characterizes host-environment interactions. Human IL-1β is synthesized as a 31 kDa precursor. To gain activity, the precursor must be cleaved by caspase-1 between Asp116 and Ala117 to yield a 17 kDa mature form. Protocols Product Specific Protocols IF protocol for IL-1 beta antibody 66737-1-Ig Download protocol IHC protocol for IL-1 beta antibody 66737-1-Ig Download protocol WB protocol for IL-1 beta antibody 66737-1-Ig Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Lighting up arginine metabolism reveals its functional diversity in physiology and pathology
Journal: Cell Metab | Authors: Rui Li | Species: human | Application: WB - Noninvasive Optogenetics Realized by iPSC-Derived Tentacled Carrier in Alzheimer's Disease Treatment
Journal: Adv Mater | Authors: Yuewen Zhai | Application: IF - Metabolomics and proteomics reveal blocking argininosuccinate synthetase 1 alleviates colitis in mice
Journal: Nat Commun | Authors: Shijia Liu | Application: WB - A cocktail hydrogel promoting the functional interneurons regeneration of human neural progenitor cells for brain injury therapy
Journal: J Adv Res | Authors: Di Zhang | Application: IF - Low-dose celecoxib-loaded PCL fibers reverse intervertebral disc degeneration by up-regulating CHSY3 expression
Journal: J Nanobiotechnology | Authors: Yunhao Wang | Application: IHC - Implantation of biomimetic polydopamine nanocomposite scaffold promotes optic nerve regeneration through modulating inhibitory microenvironment
Journal: J Nanobiotechnology | Authors: Tonghe Pan | Application: WB,IF - Macromechanics and polycaprolactone fiber organization drive macrophage polarization and regulate inflammatory activation of tendon in vitro and in vivo.
Journal: Biomaterials | Authors: Angelina D Schoenenberger | Species: human | Application: IF - IL-1β enhances susceptibility to atrial fibrillation in mice by acting through resident macrophages and promoting caspase-1 expression
Journal: Nat Cardiovasc Res | Authors: Oscar Moreno-Loaiza | Application: WB - PRMT5 regulates cell pyroptosis by silencing CASP1 in multiple myeloma.
Journal: Cell Death Dis | Authors: Tian Xia | Species: human | Application: WB - Cisplatin Induces Pyroptosis via Activation of MEG3/NLRP3/caspase-1/GSDMD Pathway in Triple-Negative Breast Cancer.
Journal: Int J Biol Sci | Authors: Honglin Yan | Species: human | Application: WB,IHC - Sodium chloride promotes macrophage pyroptosis and aggravates rheumatoid arthritis by activating SGK1 through GABA receptors Slc6a12
Journal: Int J Biol Sci | Authors: Xianzheng Zhang | Application: WB - RNF2 Modulates Lipid Metabolism and Inflammation in Alcohol-associated Liver Disease by Interacting with USP7
Journal: Int J Biol Sci | Authors: Qi Yan | Application: WB - IL-1β(+) tumor-associated macrophages accelerate glioblastoma progression by amplifying the PGE2-EP4 signaling.
Journal: J Neuroinflammation | Authors: Hao Liang | Species: human | Application: IF - Pterocephin A, a novel Triterpenoid Saponin from Pterocephalus hookeri induced liver injury by activation of necroptosis.
Journal: Phytomedicine | Authors: Rui Wang | Species: human | Application: WB - Cinchonain Ia inhibits uric acid reabsorption by binding to the TRP-459 residue of the GLUT9 protein.
Journal: Phytomedicine | Authors: Kai Li - Injectable deferoxamine-loaded microsphere hydrogels for inhibition of ferroptosis and promotion of third-degree burn wound healing
Journal: Mater Today Bio | Authors: Langjie Chai - A dual-functional Janus nanofibrous membrane as an immunomodulatory barrier for periodontitis regeneration under diabetic conditions.
Journal: Mater Today Bio | Authors: Feiyang Wang | Application: IHC - SIRT3-dependent mitochondrial redox homeostasis mitigates CHK1 inhibition combined with gemcitabine treatment induced cardiotoxicity in hiPSC-CMs and mice
Journal: Arch Toxicol | Authors: Jia-Wen Chen | Application: WB - Mediation of endoplasmic reticulum stress and NF-κB signaling pathway in DINP-exacerbated allergic asthma: A toxicological study with Balb/c mice
Journal: J Hazard Mater | Authors: Fan Lei | Application: IHC - Engineered macrophage membrane-coated nanoparticles attenuate calcium oxalate nephrocalcinosis-induced kidney injury by reducing oxidative stress and pyroptosis
Journal: Acta Biomater | Authors: Xiaozhuo Ba | Species: human | Application: WB,IF - The Stimulator of Interferon Genes Deficiency Attenuates Diabetic Myopathy Through Inhibiting NLRP3-Mediated Pyroptosis
Journal: J Cachexia Sarcopenia Muscle | Authors: Jingjuan Yang | Application: WB - ADSC-enriched adipose extract alleviates cartilage fibrosis in temporomandibular joint osteoarthritis by inhibiting chondrocyte senescence.
Journal: J Transl Med | Authors: Zerou Zhang | Species: rabbit | Application: IF - Nitrate-driven maintenance of lipid homeostasis by M2 macrophages alleviates atherosclerosis via downregulation of LOX1 expression and reduction of lipid deposition
Journal: Sci China Life Sci | Authors: Yuanchun Si | Application: WB,IF - Lars2 Deficiency-Induced Mitochondrial Dysfunction Drives the Emergence of a Pro-Inflammatory Stroke-Specific Microglial Subpopulation.
Journal: Aging Dis | Authors: Qing Zou | Application: WB - PARKIN overexpression confers cardioprotection via suppressing the mtDNA-cGAS-STING axis in myocardial ischemia/reperfusion injury.
Journal: Basic Res Cardiol | Authors: Yujing Li | Application: IHC - LRRK2 reduces the sensitivity to TKI and PD-1 blockade in ccRCC via activating LPCAT1
Journal: Oncogene | Authors: Yulong Hong | Species: human | Application: WB - Photodriven PtPdCo-TiO2 heterostructure modified with hyaluronic acid and folic acid enhances antioxidative stress through efficient hydrogen/oxygen delivery and thermal effects in rheumatoid arthritis therapy
Journal: Int J Biol Macromol | Authors: Guoquan Wu | Application: IF - A dihydromyricetin-loaded phellinus igniarius polysaccharide/l-arginine modified chitosan-based hydrogel for promoting wound recovery in diabetic mice via JNK and TGF-β/Smad signaling pathway
Journal: Int J Biol Macromol | Authors: Jiali Yang | Application: WB - Emodin modulates the NLRP3/GSDMD pathway to alleviate Fusobacterium necrophorum-induced pyroptosis in the interdigital skin fibroblasts of dairy Cows.
Journal: Int J Biol Macromol | Authors: Anchi Zhang | Species: bovine | Application: WB - Fast and versatile ice-template-assisted photocrosslinking of methacryloylated gelatin-based nanofiber sponges for regenerative wound healing.
Journal: Int J Biol Macromol | Authors: Zezhao Ding | Application: IHC - Photodriven PtPdCo-TiO2 heterostructure modified with hyaluronic acid and folic acid enhances antioxidative stress through efficient hydrogen/oxygen delivery and thermal effects in rheumatoid arthritis therapy
Journal: Int J Biol Macromol | Authors: Guoquan Wu | Application: IF - Mechanism of piR-1245/PIWI-like protein-2 regulating Janus kinase-2/signal transducer and activator of transcription-3/vascular endothelial growth factor signaling pathway in retinal neovascularization
Journal: Neural Regen Res | Authors: Yong Yu | Application: WB - Intermittent theta-burst stimulation promotes neurovascular unit remodeling after ischemic stroke in a mouse model
Journal: Neural Regen Res | Authors: Jingjun Zhang | Application: WB - Epithelial‑derived exosomes promote M2 macrophage polarization via Notch2/SOCS1 during mechanical ventilation.
Journal: Int J Mol Med | Authors: Yanting Wang | Application: WB - Targeting macrophage glycogen metabolism attenuates ulcerative colitis by suppressing IL-1β production through UDPG-P2Y(14) signaling.
Journal: Mol Med | Authors: Shuai Tong | Application: WB,IHC - Role of AhR-Hsp90-MDM2-mediated VDR ubiquitination in PM2.5-induced renal toxicity
Journal: Environ Res | Authors: Peng Zhang | Application: WB - RASSF4 attenuates metabolic dysfunction-associated steatotic liver disease progression via Hippo signaling and suppresses hepatocarcinogenesis
Journal: Cell Mol Gastroenterol Hepatol | Authors: Chaofei Xu | Species: human | Application: WB - Activation of PGC-1α via isoliquiritigenin-induced downregulation of miR-138-5p alleviates nonalcoholic fatty liver disease.
Journal: Phytother Res | Authors: Lu Wang | Species: human | Application: WB - Tremella polysaccharide microneedles loaded with magnetic dental pulp stem cell intracellular vesicles used for androgenic alopecia
Journal: Stem Cell Res Ther | Authors: Yonghao Liu | Application: WB - Puerarin inhibits inflammation and lipid accumulation in alcoholic liver disease through regulating MMP8
Journal: Chin J Nat Med | Authors: Ying Hu | Application: WB - Platycodon D protects human nasal epithelial cells from pyroptosis through the Nrf2/HO-1/ROS signaling cascade in chronic rhinosinusitis
Journal: Chin Med | Authors: Ruizhi Wang | Species: human | Application: WB - Ellagic Acid Protects Dopamine Neurons via Inhibition of NLRP3 Inflammasome Activation in Microglia.
Journal: Oxid Med Cell Longev | Authors: Xue-Mei He | Application: WB - Targeted Degradation of Prolyl Hydroxylase Domain Enzyme 1 (PHD1) as a Novel Therapeutic Strategy for Acetaminophen-Induced Acute Liver Injury.
Journal: J Med Chem | Authors: Huahua Su | Application: WB - Pesticide metabolite 3, 5, 6-Trichloro-2-pyridinol causes massive damage to the cochlea resulting in hearing loss in adult mice
Journal: Environ Pollut | Authors: Mao Huang | Application: WB - Acquiring high expression of suilysin enable non-epidemic Streptococccus suis to cause Streptococcal toxic shock-like syndrome (STSLS) through NLRP3 inflammasome hyperactivation.
Journal: Emerg Microbes Infect | Authors: Lei Xu | Species: human | Application: WB - The E3 Ubiquitin Ligase TRIM65 Negatively Regulates Inflammasome Activation Through Promoting Ubiquitination of NLRP3.
Journal: Front Immunol | Authors: Tiantian Tang | Application: WB,IP - Hexyl-aminolevulinate ethosome-mediated photodynamic therapy against acne: in vitro and in vivo analyses.
Journal: Drug Deliv Transl Res | Authors: Tai Wang | Application: IHC - ZeXieYin formula alleviates atherosclerosis by inhibiting the MAPK/NF-κB signaling pathway in APOE-/- mice to attenuate vascular inflammation and increase plaque stability
Journal: J Ethnopharmacol | Authors: Rumin Huang | Application: WB - Pi-Pa-Run-Fei-Tang alleviates lung injury by modulating IL-6/JAK2/STAT3/IL-17 and PI3K/AKT/NF-κB signaling pathway and balancing Th17 and Treg in murine model of OVA-induced asthma
Journal: J Ethnopharmacol | Authors: Xiao-Lu Jie | Application: IHC - Investigating the effect of Dingxian Pill on hippocampal neuronal pyroptosis in epilepsy through regulation of the circRNA-Csnk1g3/Wnt/β-catenin pathway.
Journal: J Ethnopharmacol | Authors: Qin Wang - Isoxanthohumol, a component of Sophora flavescens, promotes the activation of the NLRP3 inflammasome and induces idiosyncratic hepatotoxicity
Journal: J Ethnopharmacol | Authors: Li Lin | Application: WB - NLRP3 neuroinflammatory intervention of Mahuang-Lianqiao-Chixiaodou decoction for mental disorders in atopic dermatitis mice
Journal: J Ethnopharmacol | Authors: Huimin Yuan | Application: WB - Total alkaloids in Fritillaria cirrhosa D. Don alleviate OVA-induced allergic asthma by inhibiting M2 macrophage polarization
Journal: J Ethnopharmacol | Authors: Yu Wang | Application: WB - Mechanic study based on untargeted metabolomics of Pi-pa-run-fei-tang on pepper combined with ammonia induced chronic cough model mice
Journal: J Ethnopharmacol | Authors: Xiao-Lu Jie - Mechanic study based on untargeted metabolomics of Pi-pa-run-fei-tang on pepper combined with ammonia induced chronic cough model mice
Journal: J Ethnopharmacol | Authors: Xiao-Lu Jie - Inflammatory mechanisms of Ginkgo Biloba extract in improving memory functions through lncRNA-COX2/NF-κB pathway in mice with status epilepticus
Journal: CNS Neurosci Ther | Authors: Xiaopei Zou | Application: WB - A MULTICENTER, SINGLE-BLIND, CASE-CONTROL, IMMUNOHISTOCHEMICAL STUDY OF ORBITAL TISSUE IN THYROID EYE DISEASE
Journal: Thyroid | Authors: YuanPing Hai | Species: human | Application: IHC - Ginsenoside Rg1 alleviates MASH by targeting GLS2 to enhance PINK1/Parkin-mediated mitophagy and improve mitochondrial function.
Journal: Biochem Pharmacol | Authors: Zhijian Wang | Application: WB - PROM2 exacerbates CCl4-Induced liver fibrosis via NLRP3 inflammasome activation and hepatocyte pyroptosis.
Journal: Cell Mol Life Sci | Authors: Jiashi Guo | Application: WB - HUVEC-derived exosomes alleviate lipopolysaccharide-induced acute lung injury inflammation by restoring the balance of mitochondrial fusion and division.
Journal: Cell Mol Life Sci | Authors: Wei Lai | Species: human | Application: IF - PROM2 exacerbates CCl4-Induced liver fibrosis via NLRP3 inflammasome activation and hepatocyte pyroptosis.
Journal: Cell Mol Life Sci | Authors: Jiashi Guo | Application: WB - GSTK1 alleviates ectopic fat deposition as a protective mechanism against diabetic renal tubulointerstitial lesions.
Journal: Life Sci | Authors: Hong Chen | Species: human | Application: WB - Overexpression of MicroRNA-155 Aggravates Pulpitis by Targeting Kinesin Superfamily Proteins-5C Based on Illumina High-Throughput Sequencing
Journal: Int Endod J | Authors: Ye Jiang | Species: human | Application: IHC - Hepatoprotective effects of ginsenoside Rk3 in acetaminophen-induced liver injury in mice by activation of autophagy.
Journal: Food Funct | Authors: Linlin Qu | Application: WB - Ginsenoside Rh4 alleviates antibiotic-induced intestinal inflammation by regulating the TLR4-MyD88-MAPK pathway and gut microbiota composition.
Journal: Food Funct | Authors: Xue Bai | Application: WB - Blockade of the P2Y2 Receptor Attenuates Alcoholic Liver Inflammation by Targeting the EGFR-ERK1/2 Signaling Pathway.
Journal: Drug Des Devel Ther | Authors: Zhen-Ni Liu | Application: WB - Cluster of Differentiation-44-Targeting Prussian Blue Nanoparticles Onloaded with Colchicine for Atherosclerotic Plaque Regression in a Mice Model
Journal: ACS Biomater Sci Eng | Authors: Yan Zhu | Species: human | Application: WB - Integrative transcriptomic and metabonomic profiling analyses reveal the molecular mechanism of Chinese traditional medicine huankuile suspension on TNBS-induced ulcerative colitis.
Journal: Aging (Albany NY) | Authors: Zhenglan Han | Application: WB - Polyvinylpyrrolidone-Modified Taxifolin Liposomes Promote Liver Repair by Modulating Autophagy to Inhibit Activation of the TLR4/NF-κB Signaling Pathway.
Journal: Front Bioeng Biotechnol | Authors: Qiteng Ding | Application: WB - NLRP3 promotes inflammatory signaling and IL-1β cleavage in acute lung injury caused by cell wall extract of Lactobacillus casei
Journal: Commun Biol | Authors: Lingui Gu | Species: human | Application: WB,IHC - Vascular endothelial growth factor attenuates neointimal hyperplasia of decellularized small-diameter vascular grafts by modulating the local inflammatory response
Journal: Front Bioeng Biotechnol | Authors: Xinlong Xie | Application: IF - Degradation of NLRP3 by selective ROCK2 inhibitor alleviates acute lung injury
Journal: Eur J Pharmacol | Authors: Shuai Zhan - Isoorientin protects lipopolysaccharide-induced acute lung injury in mice via modulating Keap1/Nrf2-HO-1 and NLRP3 inflammasome pathways.
Journal: Eur J Pharmacol | Authors: Lu Zhang | Application: WB - P2Y14 receptor in trigeminal ganglion contributes to neuropathic pain in mice
Journal: Eur J Pharmacol | Authors: Jiu Lin | Application: WB - Degradation of NLRP3 by selective ROCK2 inhibitor alleviates acute lung injury
Journal: Eur J Pharmacol | Authors: Shuai Zhan - Baicalin downregulates Thromboxane A(2) receptor via SIRT1/NRF2 and NLRP3 pathways to attenuate Cyclosporine A-induced hypertension.
Journal: Eur J Pharmacol | Authors: Teng Gao - Adenosine A2A Receptor Contributes to Bidirectional Remodeling of Microglial Inflammatory Responses During Methamphetamine Exposure.
Journal: Int J Mol Sci | Authors: Zhenping Hou - CD36-mediated fatty acid metabolic reprogramming activates synovial fibroblasts and promotes rheumatoid arthritis progression.
Journal: Int Immunopharmacol | Authors: Jiayao Hao | Species: human | Application: WB - ROS-activated MAPK/ERK pathway regulates crosstalk between Nrf2 and Hif-1α to promote IL-17D expression protecting the intestinal epithelial barrier under hyperoxia
Journal: Int Immunopharmacol | Authors: Pingchuan Wang | Species: human | Application: WB - CD36-mediated fatty acid metabolic reprogramming activates synovial fibroblasts and promotes rheumatoid arthritis progression.
Journal: Int Immunopharmacol | Authors: Jiayao Hao | Species: human | Application: WB - Jatrorrhizine retard obesity by modulating transcription factor c-Jun/c-Fos to downregulate Mmp12-mediated inflammation
Journal: Int Immunopharmacol | Authors: Zhengcai Ma | Application: WB - Methyl Gallate Alleviates Acute Ulcerative Colitis by Modulating Gut Microbiota and Inhibiting TLR4/NF-κB Pathway
Journal: Int J Mol Sci | Authors: Ping Zhou | Application: WB - Novel mechanism of Clostridium butyricum alleviated coprophagy prevention-induced intestinal inflammation in rabbit
Journal: Int Immunopharmacol | Authors: Zhichao Li | Species: rabbit | Application: WB - Diosgenin attenuates metabolic-associated fatty liver disease through the hepatic NLRP3 inflammasome-dependent signaling pathway
Journal: Int Immunopharmacol | Authors: Wenfei Yu | Species: human | Application: WB - The P2Y14 receptor in the trigeminal ganglion contributes to the maintenance of inflammatory pain.
Journal: Neurochem Int | Authors: Jiu Lin | Application: WB - Elevation of α-1,3 fucosylation promotes the binding ability of TNFR1 to TNF-α and contributes to osteoarthritic cartilage destruction and apoptosis.
Journal: Arthritis Res Ther | Authors: Hanjie Yu | Species: human | Application: WB - Hesperetin Exhibits Anti-Inflammatory Effects on Chondrocytes via the AMPK Pathway to Attenuate Anterior Cruciate Ligament Transection-Induced Osteoarthritis
Journal: Front Pharmacol | Authors: Jiaqin Wu | Application: WB - Bacteroides dorei BDX-01 alleviates DSS-induced experimental colitis in mice by regulating intestinal bile salt hydrolase activity and the FXR-NLRP3 signaling pathway
Journal: Front Pharmacol | Authors: Xiaowei Sun | Species: human | Application: WB - NLRP3 neuroinflammatory factors may be involved in atopic dermatitis mental disorders: an animal study
Journal: Front Pharmacol | Authors: Huimin Yuan | Application: WB - An Integrative Pharmacology Based Analysis of Refined Liuweiwuling Against Liver Injury: A Novel Component Combination and Hepaprotective Mechanism.
Journal: Front Pharmacol | Authors: Yuan Gao | Application: WB,ELISA - IGF-1 inhibits inflammation and accelerates angiogenesis via Ras/PI3K/IKK/NF-κB signaling pathways to promote wound healing
Journal: Eur J Pharm Sci | Authors: Xin Zhang | Application: WB - Astragaloside IV attenuates podocyte apoptosis via regulating TXNIP/NLRP3/GSDMD signaling pathway in diabetic nephropathy
Journal: Diabetol Metab Syndr | Authors: Zhibo Hu - Polystyrene microplastics induce liver fibrosis and lipid deposition in mice through three hub genes revealed by the RNA-seq
Journal: Sci Rep | Authors: Qingwen Li | Application: WB - Macrophages enhance lipopolysaccharide induced apoptosis via Ang1 and NF-κB pathways in human umbilical vein endothelial cells.
Journal: Sci Rep | Authors: Guo-Long Cai | Species: human | Application: WB - Aronia melanocarpa polysaccharide ameliorates inflammation and aging in mice by modulating the AMPK/SIRT1/NF-κB signaling pathway and gut microbiota
Journal: Sci Rep | Authors: Yingchun Zhao | Application: WB - FTO triggers NLRP3/GSDMD-dependent pyroptosis to enhance cisplatin-sensitivity in ovarian cancer
Journal: Cell Signal | Authors: Fubin Zhang | Species: human | Application: WB - FTO triggers NLRP3/GSDMD-dependent pyroptosis to enhance cisplatin-sensitivity in ovarian cancer
Journal: Cell Signal | Authors: Fubin Zhang | Species: human | Application: WB - Run-Mu-Ling Granules Mitigate Ocular Surface Inflammatory Injury Associated with Dry Eye by Suppressing the NLRP3/GSDMD-Mediated Pyroptosis Pathway
Journal: J Inflamm Res | Authors: Dan Luo | Species: human | Application: WB - Long Noncoding RNA AC078850.1 Induces NLRP3 Inflammasome-Mediated Pyroptosis in Atherosclerosis by Upregulating ITGB2 Transcription via Transcription Factor HIF-1α
Journal: Biomedicines | Authors: Yu Tian | Species: human | Application: WB - Agaricus blazei Murrill Polysaccharide Attenuates Periodontitis via H2 S/NRF2 Axis-Boosted Appropriate Level of Autophagy in PDLCs
Journal: Mol Nutr Food Res | Authors: Wenxiu Yuan | Species: human | Application: WB,IF - KGF-2 and FGF-21 poloxamer 407 hydrogel coordinates inflammation and proliferation homeostasis to enhance wound repair of scalded skin in diabetic rats.
Journal: BMJ Open Diabetes Res Care | Authors: Xuanxin Yang | Application: WB - Buddleoside-rich Chrysanthemum indicum L. extract modulates macrophage-mediated inflammation to prevent metabolic syndrome induced by unhealthy diet
Journal: BMC Complement Med Ther | Authors: Yiqing Zhou | Application: IHC - Escherichia coli infection mediates pyroptosis via activating p53-p21 pathway-regulated apoptosis and cell cycle arrest in bovine mammary epithelial cells
Journal: Microb Pathog | Authors: Cuicui Zhuang | Species: bovine | Application: WB - Exploring the therapeutic potential of puerarin on intervertebral disc degeneration by regulating apoptosis of nucleus pulposus cells
Journal: JOR Spine | Authors: Xiaoqiang Wang | Species: Human | Application: WB - Long non-coding RNA lncC11orf54-1 modulates neuroinflammatory responses by activating NF-κB signaling during meningitic Escherichia coli infection
Journal: Mol Brain | Authors: Bojie Xu | Species: human | Application: WB - Electroacupuncture ameliorates surgery-induced spatial memory deficits by promoting mitophagy in rats
Journal: Ann Transl Med | Authors: Jian Guo | Application: WB - Novel insights into the effect of deer IGF-1 on chondrocyte viability and IL-1β-induced inflammation response
Journal: J Biochem Mol Toxicol | Authors: Jinghong Zhong | Application: Cell treatment - l-Arginine prevents 4-hydroxy-2-nonenal accumulation and depresses inflammation via inhibiting NF-κB activation.
Journal: J Biochem Mol Toxicol | Authors: Mingcai Liang | Application: WB - Novel insights into the effect of deer IGF-1 on chondrocyte viability and IL-1β-induced inflammation response
Journal: J Biochem Mol Toxicol | Authors: Jinghong Zhong | Application: Cell treatment - Neuroprotective Action of Teriflunomide in a Mouse Model of Transient Middle Cerebral Artery Occlusion.
Journal: Neuroscience | Authors: Zhengfang Lu | Application: WB - Age-Associated Dopaminergic Neuron Loss and Midbrain Glia Cell Phenotypic Polarization.
Journal: Neuroscience | Authors: GuoQing Wang | Application: WB,IF - Empagliflozin inhibits macrophage inflammation through AMPK signaling pathway and plays an anti-atherosclerosis role
Journal: Int J Cardiol | Authors: Jie Fu | Application: IHC - Metformin Improves the Prognosis of Adult Mice with Sepsis-Associated Encephalopathy Better than That of Aged Mice.
Journal: J Immunol Res | Authors: Gaofei Song | Application: WB - Elucidating the role of IgA plasma cells and PECAM1-CD38 interaction in intestinal fibrosis: a single-cell RNA sequencing analysis in Crohn's disease.
Journal: BMC Gastroenterol | Authors: Shuyang Sun | Species: human | Application: IHC - β-hydroxybutyrate impairs monocyte function via the ROS-NLR family pyrin domain-containing three inflammasome (NLRP3) pathway in ketotic cows
Journal: Front Vet Sci | Authors: Zhihao Dong | Species: bovine | Application: WB - Exosome-Derived LncRNA TCONS_00072128 Mediated Osteogenic Differentiation and Inflammation by Caspase 8 Regulation.
Journal: Front Genet | Authors: Yongchang Yang | Species: human | Application: WB - Zerumbone attenuates the excessive proliferation of keratinocytes in psoriasis mice through regulating NLRP3/NF-κB pathway
Journal: Toxicol Res (Camb) | Authors: Jin Lin | Application: ELISA - TAK-242 Ameliorates Hepatic Fibrosis by Regulating the Liver-Gut Axis
Journal: Biomed Res Int | Authors: Sujie Liu | Application: IHC - Exploration of the Therapeutic Time Window for Thrombectomy in Rat Models of Middle Cerebral Artery Ischemia-Reperfusion
Journal: Brain Behav | Authors: Yuting He | Application: IHC - Impact of intra-articular high-concentration hyaluronic acid administration on the innate immune response in experimental knee osteoarthritis.
Journal: BMC Musculoskelet Disord | Authors: Gabriel Herrero-Beaumont | Species: rabbit | Application: IHC - CCL24 Protects Renal Function by Controlling Inflammation in Podocytes.
Journal: Dis Markers | Authors: Youdi Wang | Application: WB - Reticuline alleviates rheumatoid arthritis by suppressing the JAK/STAT signaling pathway.
Journal: Clin Rheumatol | Authors: Jimei Tian - Overexpression of SESN1 improves mitochondrial damage and mitophagy, a potential therapeutic strategy for cognitive dysfunction after anaesthesia
Journal: Eur J Neurosci | Authors: Li Sun | Application: WB - Inhibition of mGluR5 ameliorates lipid accumulation and inflammation in HepG2 cells
Journal: Biochem Biophys Res Commun | Authors: Shu Zeng | Species: human | Application: WB - Loganin exerts neuroprotective effect by inhibiting neuronal pyroptosis in rat with cerebral haemorrhage
Journal: Clin Exp Pharmacol Physiol | Authors: Yu Wang | Application: WB - d-mannose attenuates lipopolysaccharide-induced osteolysis via CPT1A-Mediated lipid metabolic regulation in macrophages.
Journal: Biochem Biophys Res Commun | Authors: Zhenzhen Zhang | Application: WB,IF - In vitro and in vivo effects of hyperglycemia and diabetes mellitus on nucleus pulposus cell senescence.
Journal: J Orthop Res | Authors: Zengxin Jiang | Species: human | Application: IHC - Low-intensity pulsed ultrasound inhibits IL-6 in subchondral bone of temporomandibular joint osteoarthritis by suppressing the TGF-β1/Smad3 pathway.
Journal: Arch Oral Biol | Authors: Xin Yi | Application: WB,IF - An Immunogenic Cell Death-Related Gene Signature Predicts the Prognosis and Immune Infiltration of Cervical Cancer
Journal: Cancer Inform | Authors: Fangfang Sun | Species: human | Application: WB - The Correlation between Increased Expressions of NLRP3 Inflammasome Components in Peripheral Blood Mono-Nuclear Cells and Plaque Vulnerability in Human Carotid Atherosclerosis
Journal: Iran J Public Health | Authors: Wenli Xie | Species: human | Application: WB - Forsythiaside A alleviates Lipopolysacchrride-induced acute liver Injury through inhibiting endoplasmic reticulum stress and NLRP3 inflammasome activation
Journal: Biol Pharm Bull | Authors: Jing-Nan Fu | Application: WB - Sodium butyrate inhibits activation of ROS/NF-κB/NLRP3 signaling pathway and angiogenesis in human retinal microvascular endothelial cells
Journal: Int Ophthalmol | Authors: Xin Cao | Species: human | Application: WB - Dioscin Attenuates Myocardial Damages in Diabetic Rats maybe by Regulating NO-sGC-cGMP-PKG Pathway.
Journal: Ann Clin Lab Sci | Authors: Qian Wei | Application: WB - Lactobacillus rhamnosus GR-1 Coameliorates Tight Junction Disruption and NLRP3-Mediated Inflammation in Drug-Resistant Trueperella pyogenes Infection.
Journal: J Agric Food Chem | Authors: Ning Liu - Farrerol alleviates hepatic ischemia-reperfusion injury by regulating the CD14/MyD88/NF-κB signaling pathway.
Journal: Int Immunopharmacol | Authors: Hongliang Liang | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
