CD69 Monoclonal antibody 68827-1-Ig proteintech
$149.00
In stock
SKU
68827-1-Ig
| Catalog Number | 68827-1-Ig |
| Synonyms | Activation inducer molecule, AIM, BL AC/P26, CD69, CD69 molecule, CLEC2C, EA1, Early activation antigen CD69, GP32/28, MLR 3 |
| Host | Mouse |
| Reactivity | Human |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, ELISA |
| Host / Isotype | Mouse / IgG3 |
| Tested Applications — Positive WB detected in | U-937 cells, THP-1 cells, HL-60 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Positive WB detected in | U-937 cells, THP-1 cells, HL-60 cells |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Tested Reactivity | Human |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag30963 Product name: Recombinant human CD69 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 100-199 aa of BC007037 Sequence: STVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK Predict reactive species |
| Full Name | CD69 molecule |
| Calculated Molecular Weight | 23 kDa |
| Observed Molecular Weight | 30 kDa |
| GenBank Accession Number | BC007037 |
| Gene Symbol | CD69 |
| Gene ID (NCBI) | 969 |
| RRID | AB_3670438 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q07108 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for CD69 antibody 68827-1-Ig | Download protocol |
| Citations | - |
| Dilutions | WB : 1:5000-1:50000 |
| Isotype | IgG3 |
| Clonality | Monoclonal |
| Clone Number | 3D10A2 |
| Conjugation | Unconjugated |
CD69, also known as AIM, EA-1, Leu-23, and MLR3, is a type II transmembrane glycoprotein that belongs to the C-type lectin superfamily (PMID: 8340758; 7804122). CD69 is constitutively expressed by mature thymocytes, platelets, and several subsets of tissue-resident immune cells (including resident memory T cells and gamma delta T cells), and is inducibly expressed by activated T cells, B cells, natural killer (NK) cells, monocytes, neutrophils (PMID: 8100776; 28475283). CD69 has been identified as an early activation marker of lymphocytes and is commonly used as a marker of activated lymphocytes and NK cells (PMID: 28475283; 25759842). It is involved in regulating immune responses (PMID: 15745855). Protocols Product Specific Protocols WB protocol for CD69 antibody 68827-1-Ig Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
