PE-CoraLite® Plus 594 Anti-Human CD69 Rabbit Recombinant Antibody PCL594-98173-2 proteintech
$216.00
In stock
SKU
PCL594-98173-2
| Catalog Number | PCL594-98173-2 |
| Synonyms | Activation inducer molecule, AIM, BL AC/P26, BL-AC/P26, CD69 molecule |
| Host | Rabbit |
| Reactivity | human, cynomolgus monkey |
| Form | Liquid |
| Formulation | PBS, Azide, BSA |
| Applications | FC |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive FC detected in | PHA treated human PBMCs |
| Positive FC detected in | PHA treated human PBMCs |
| Flow Cytometry (FC) | FC : 5 ul per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | human, cynomolgus monkey |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg1791 Product name: Recombinant Human CD69 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 62-199 aa of NM_001781.2 Sequence: SVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK Predict reactive species |
| Full Name | CD69 molecule |
| Calculated Molecular Weight | 23 kDa |
| GenBank Accession Number | NM_001781.2 |
| Gene Symbol | CD69 |
| Gene ID (NCBI) | 969 |
| RRID | AB_3749488 |
| Conjugate | PE-CoraLite® Plus 594 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 496 nm, 565 nm / 604 nm |
| Excitation Laser | Blue Laser (488 nm), Green Laser (532 nm), Yellow-Green Laser (561 nm) |
| Purification Method | Protein A purification |
| UNIPROT ID | Q07108 |
| Storage Buffer | PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. |
| FC protocol for PE-CL Plus 594 CD69 antibody PCL594-98173-2 | Download protocol |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 241552G10 |
| Conjugation | PE-CoraLite® Plus 594 |
CD69, also known as AIM, EA-1, Leu-23, and MLR3, is a type II transmembrane glycoprotein that belongs to the C-type lectin superfamily (PMID: 8340758; 7804122). CD69 is constitutively expressed by mature thymocytes, platelets, several subsets of tissue resident immune cells (including resident memory T cells and gamma delta T cells), and is inducibly expressed by activated T cells, B cells, natural killer (NK) cells, monocytes, neutrophils (PMID: 8100776; 28475283). CD69 has been identified as an early activation marker of lymphocytes and is commonly used as a marker of activated lymphocytes and NK cells (PMID: 28475283; 25759842). It is involved in the regulation of immune responses (PMID: 15745855). Protocols Product Specific Protocols FC protocol for PE-CL Plus 594 CD69 antibody PCL594-98173-2 Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
