CD82 Recombinant monoclonal antibody, PBS Only 84617-1-PBS proteintech
$699.00
In stock
SKU
84617-1-PBS
| Catalog Number | 84617-1-PBS |
| Synonyms | CD82, KAI1, CD 82, CD82,KAI1, IA4, Metastasis suppressor Kangai-1 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg1749 Product name: Recombinant Human CD82 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 111-228 aa of NM_002231.4 Sequence: GKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENL Predict reactive species |
| Full Name | CD82 molecule |
| Calculated Molecular Weight | 30 kDa |
| GenBank Accession Number | NM_002231.4 |
| Gene Symbol | CD82 |
| Gene ID (NCBI) | 3732 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P27701-1 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 241765B2 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
