Mouse CD83 Recombinant monoclonal antibody, PBS Only (Detector) 83907-4-PBS proteintech
$699.00
In stock
SKU
83907-4-PBS
| Catalog Number | 83907-4-PBS |
| Synonyms | CD83 antigen, mCD83 |
| Host | Rabbit |
| Reactivity | mouse |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | mouse |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg1387 Product name: Recombinant Mouse CD83 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 22-133 aa of NM_009856.3 Sequence: MREVTVACSETADLPCTAPWDPQLSYAVSWAKVSESGTESVELPESKQNSSFEAPRRRAYSLTIQNTTICSSGTYRCALQELGGQRNLSGTVVLKVTGCPKEATESTFRKYR Predict reactive species |
| Full Name | CD83 antigen |
| Calculated Molecular Weight | 21 kDa |
| GenBank Accession Number | NM_009856.3 |
| Gene Symbol | Cd83 |
| Gene ID (NCBI) | 12522 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | O88324 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 241002E10 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
