Gamma Tubulin Monoclonal antibody 66320-1-Ig proteintech
$189.00
In stock
SKU
66320-1-Ig
| Catalog Number | 66320-1-Ig ab11316 5886 T6557 |
| Synonyms | TUBG1, 3F9H8, Gamma-1-tubulin, Gamma-tubulin complex component 1, GCP-1 |
| Host | Mouse Mouse Rabbit Mouse |
| Reactivity | human, mouse, rat, canine |
| Reactivity | human, mouse, rat, canine Mouse, Chicken, Cow, Dog, Human, African green monkey, Chinese hamster Human, Mouse, Rat, Monkey rat, hamster, chicken, human, bovine, canine, Xenopus , mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, FC (Intra), ELISA |
| Applications | WB, IHC, IF/ICC, FC (Intra), ELISA ICC/IF,WB, WB, ELISA (i), ICC, WB |
| Host / Isotype | Mouse / IgG2a |
| Tested Applications — Positive WB detected in | NCCIT cells, HepG2 cells, EC109 cells, K-562 cells, HSCT6 cells, NIH3T3 cells |
| Tested Applications — Positive IHC detected in | human breast cancer tissue, human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | MDCK cells, HeLa cells, A549 cells |
| Tested Applications — Positive FC (Intra) detected in | HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:2000-1:12000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:200-1:1000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Recommended Dilutions — Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Positive WB detected in | NCCIT cells, HepG2 cells, EC109 cells, K-562 cells, HSCT6 cells, NIH3T3 cells |
| Positive IHC detected in | human breast cancer tissue, human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MDCK cells, HeLa cells, A549 cells |
| Positive FC (Intra) detected in | HeLa cells |
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | human, mouse, rat, canine |
| Cited Reactivity | human, mouse, rat |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag23913 Product name: Recombinant human tubulin-gamma protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 150-451 aa of BC000619 Sequence: GSYLLERLNDRYPKKLVQTYSVFPNQDEMSDVVVQPYNSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDEMDTSREIVQQLIDEYHAATRPDYISWGTQEQ Predict reactive species |
| Full Name | tubulin, gamma 1 |
| Calculated Molecular Weight | 51 kDa |
| Observed Molecular Weight | 48-55 kDa |
| GenBank Accession Number | BC000619 |
| Gene Symbol | Gamma Tubulin |
| Gene ID (NCBI) | 7283 |
| RRID | AB_2857350 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P23258 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| FC protocol for Gamma Tubulin antibody 66320-1-Ig | Download protocol |
| IF protocol for Gamma Tubulin antibody 66320-1-Ig | Download protocol |
| IHC protocol for Gamma Tubulin antibody 66320-1-Ig | Download protocol |
| WB protocol for Gamma Tubulin antibody 66320-1-Ig | Download protocol |
| human | WB,IF J Nanobiotechnology GRP75-driven, cell-cycle-dependent macropinocytosis of Tat/pDNA-Ca2+ nanoparticles underlies distinct gene therapy effect in ovarian cancer. Authors - Linjia Su View Article |
| mouse | WB J Cell Biol Time-resolved proteomics profiling of the ciliary Hedgehog response. Authors - Elena A May View Article |
| Lola (Verified Customer) (10-23-2025) | This antibody works well. Suitable for immunofluorescence and expansion microscopy. We use cold MeOH fixation. Applications: Immunofluorescence Primary Antibody Dilution: 1:200 Cell Tissue Type: Primary myoblasts Gamma Tubulin Antibody Immunofluorescence validation (1:200 dilution) in Primary myoblasts (Cat no:66320-1-Ig) |
| Citations | 40 150 15 1431 |
| Dilutions | WB : 1:2000-1:12000 IHC : 1:200-1:1000 IF/ICC : 1:50-1:500 FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension ICC/IF:Use a concentration of 1 - 2 μg/ml. WB:1/10000. Detects a band of approximately 48 kDa (predicted molecular weight: 48 kDa). Western Blotting1:1000 immunocytochemistry: 1:5,000-1:10,000 using HeLa cellsindirect ELISA: suitablewestern blot: 1:10,000 using cultured chicken fibroblast extract |
| Isotype | IgG2a IgG1 - IgG1 |
| Clonality | Monoclonal Monoclonal Polyclonal Monoclonal |
| Clone Number | 3F9H8 GTU-88 - GTU-88 |
| Conjugation | Unconjugated Unconjugated Unconjugated Unconjugated |
Gamma tubulin is a member of tubulin superfamily and is a key component required for microtubule nucleation and stabilization. It is concentrated at the pericentriolar material of centrosomes in interphase cells, predominantly on spindle poles in mitotic cells, while found in midbodies during cytokinesis. Overexpression of gamma tubulin has been found in various cancers including breast cancer and gliomas. This antibody can well label the centrosome structure. Protocols Product Specific Protocols FC protocol for Gamma Tubulin antibody 66320-1-Ig Download protocol IF protocol for Gamma Tubulin antibody 66320-1-Ig Download protocol IHC protocol for Gamma Tubulin antibody 66320-1-Ig Download protocol WB protocol for Gamma Tubulin antibody 66320-1-Ig Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Structure of LRRK2 in Parkinson's disease and model for microtubule interaction.
Journal: Nature | Authors: C K Deniston | Species: human | Application: WB - Mutations in GRK2 cause Jeune syndrome by impairing Hedgehog and canonical Wnt signaling.
Journal: EMBO Mol Med | Authors: Michaela Bosakova | Application: IF - Time-resolved proteomics profiling of the ciliary Hedgehog response.
Journal: J Cell Biol | Authors: Elena A May | Species: mouse | Application: WB - MYO10 regulates genome stability and cancer inflammation through mediating mitosis
Journal: Cell Rep | Authors: Franklin Mayca Pozo | Application: IF - Respiratory syncytial virus co-opts host mitochondrial function to favour infectious virus production.
Journal: Elife | Authors: MengJie Hu | Species: human | Application: IF - GRP75-driven, cell-cycle-dependent macropinocytosis of Tat/pDNA-Ca2+ nanoparticles underlies distinct gene therapy effect in ovarian cancer.
Journal: J Nanobiotechnology | Authors: Linjia Su | Species: human | Application: WB,IF
Reviews
Write Your Own Review