CDK2 Recombinant monoclonal antibody, PBS Only 83635-4-PBS proteintech
$699.00
In stock
SKU
83635-4-PBS
| Catalog Number | 83635-4-PBS |
| Synonyms | EC:2.7.11.22, Cyclin-dependent kinase 2, Cyclin dependent kinase 2, Cell division protein kinase 2, CDKN2 |
| Host | Rabbit |
| Reactivity | human, rat |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | WB, FC (Intra), ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human, rat |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag17133 Product name: Recombinant human CDK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 217-298 aa of BC003065 Sequence: RTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL Predict reactive species |
| Full Name | cyclin-dependent kinase 2 |
| Calculated Molecular Weight | 298 aa, 34 kDa |
| Observed Molecular Weight | 30-33 kDa |
| GenBank Accession Number | BC003065 |
| Gene Symbol | CDK2 |
| Gene ID (NCBI) | 1017 |
| RRID | AB_3671246 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purfication |
| UNIPROT ID | P24941 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240580A11 |
| Conjugation | Unconjugated |
CDK2(Cyclin-dependent kinase 2) is also named as CDKN2 and belongs to the protein kinase superfamily,CMGC Ser/Thr protein kinase family, CDC2/CDKX subfamily.It is involved in the control of the cell cycle; essential for meiosis, but dispensable for mitosis.It has 2 isoforms produced by alternative splicing.
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
