CDK5R2/p39 Polyclonal antibody 27058-1-AP proteintech
$149.00
In stock
SKU
27058-1-AP
| Catalog Number | 27058-1-AP |
| Synonyms | CDK5 activator 2, CDK5R2, CDK5R2/p39, NCK5AI, P39, p39I, p39nck5ai |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | Neuro-2a cells, mouse brain tissue, rat brain tissue |
| Tested Applications — Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | Neuro-2a cells, mouse brain tissue, rat brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag25834 Product name: Recombinant human CDK5R2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 9-75 aa of BC041771 Sequence: PASSAKGRRPGGLPEEKKKAPPAGDEALGGYGAPPVGKGGKGESRLKRPSVLISALTWRRLVAASAK Predict reactive species |
| Full Name | cyclin-dependent kinase 5, regulatory subunit 2 (p39) |
| Observed Molecular Weight | 39 kDa |
| GenBank Accession Number | BC041771 |
| Gene Symbol | CDK5R2/p39 |
| Gene ID (NCBI) | 8941 |
| RRID | AB_2880735 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13319 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for CDK5R2/p39 antibody 27058-1-AP | Download protocol |
| WB protocol for CDK5R2/p39 antibody 27058-1-AP | Download protocol |
| human | WB,IHC BMC Cancer m1A regulator-mediated methylation modification patterns correlated with autophagy to predict the prognosis of hepatocellular carcinoma Authors - Yingmin Wu View Article |
| Citations | 1 |
| Dilutions | WB : 1:500-1:1000 IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
CDK5R2 is a neuron-specific activator of CDK5 kinase. It associates with CDK5 to form an active kinase. This protein and neuron-specific CDK5 activator CDK5R1/p39NCK5A both share limited similarity to cyclins, and thus may define a distinct family of cyclin-dependent kinase activating proteins. Protocols Product Specific Protocols IHC protocol for CDK5R2/p39 antibody 27058-1-AP Download protocol WB protocol for CDK5R2/p39 antibody 27058-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- m1A regulator-mediated methylation modification patterns correlated with autophagy to predict the prognosis of hepatocellular carcinoma
Journal: BMC Cancer | Authors: Yingmin Wu | Species: human | Application: WB,IHC
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
