CDK8 Recombinant monoclonal antibody, PBS Only (Detector) 83621-4-PBS proteintech
$699.00
In stock
SKU
83621-4-PBS
| Catalog Number | 83621-4-PBS |
| Synonyms | Cell division protein kinase 8, Cyclin dependent kinase 8, Cyclin-dependent kinase 8, EC:2.7.11.22, K35 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag17148 Product name: Recombinant human CDK8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 360-464 aa of BC069634 Sequence: TEEEPDDKGDKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY Predict reactive species |
| Full Name | cyclin-dependent kinase 8 |
| Calculated Molecular Weight | 464 aa, 53 kDa |
| GenBank Accession Number | BC069634 |
| Gene Symbol | CDK8 |
| Gene ID (NCBI) | 1024 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P49336 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240598C4 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
