CD11c Monoclonal antibody 60258-1-Ig proteintech
$149.00
In stock
SKU
60258-1-Ig
| Catalog Number | 60258-1-Ig |
| Synonyms | 2F1C10, CD11 antigen-like family member C, Integrin alpha X, Integrin alpha-X, ITGAX |
| Host | Mouse |
| Reactivity | human and More (2) |
| Reactivity | human, rat, pig |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF-P, ELISA |
| Host / Isotype | Mouse / IgG2a |
| Tested Applications — Positive WB detected in | human spleen tissue, THP-1 cells, HL-60 cells, U-937 cells |
| Tested Applications — Positive IHC detected in | human tonsillitis tissue, human lung cancer tissue, human breast cancer tissue, human liver cancer tissue, human appendicitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF-P detected in | human tonsillitis tissue, human appendicitis tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:10000-1:40000 |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:500-1:2000 |
| Positive WB detected in | human spleen tissue, THP-1 cells, HL-60 cells, U-937 cells |
| Positive IHC detected in | human tonsillitis tissue, human lung cancer tissue, human breast cancer tissue, human liver cancer tissue, human appendicitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human tonsillitis tissue, human appendicitis tissue |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:10000-1:40000 |
| Immunofluorescence (IF)-P | IF-P : 1:500-1:2000 |
| Tested Reactivity | human |
| Cited Reactivity | human, rat, pig |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag11350 Product name: Recombinant human CD11c/Integrin alpha X protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 21-352 aa of BC038237 Sequence: NLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLFHASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMA Predict reactive species |
| Full Name | integrin, alpha X (complement component 3 receptor 4 subunit) |
| Calculated Molecular Weight | 1169 aa, 129 kDa |
| Observed Molecular Weight | 145 kDa |
| GenBank Accession Number | BC038237 |
| Gene Symbol | CD11c |
| Gene ID (NCBI) | 3687 |
| ENSEMBL Gene ID | ENSG00000140678 |
| RRID | AB_2881379 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P20702 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for CD11c antibody 60258-1-Ig | Download protocol |
| IHC protocol for CD11c antibody 60258-1-Ig | Download protocol |
| WB protocol for CD11c antibody 60258-1-Ig | Download protocol |
| human | IF Diabetes Loss of IDO1 Expression From Human Pancreatic β-Cells Precedes Their Destruction During the Development of Type 1 Diabetes. Authors - Florence Anquetil View Article |
| Emma (Verified Customer) (11-29-2021) | Works well by IF on FFPE tissue at 1:500. We used a Tris-EDTA pH 9.0 antigen retrieval. Applications: Immunofluorescence Primary Antibody Dilution: 1:500 Cell Tissue Type: Prostate |
| Citations | 33 |
| Dilutions | WB : 1:500-1:2000 IHC : 1:10000-1:40000 IF-P : 1:500-1:2000 |
| Isotype | IgG2a |
| Clonality | Monoclonal |
| Clone Number | 2F1C10 |
| Conjugation | Unconjugated |
Integrins are cell adhesion receptors that are heterodimers composed of non-covalently associated α and β subunits. CD11c/Integrin alpha X is a 145-150 kDa type I transmembrane glycoprotein present on a variety of cells, including monocytes/macrophages, granulocytes, NK cells and dendritic cells. Integrin alpha X/beta 2 acts a receptor for fibrinogen and is important in monocyte adhesion and chemotaxis. Protocols Product Specific Protocols IF protocol for CD11c antibody 60258-1-Ig Download protocol IHC protocol for CD11c antibody 60258-1-Ig Download protocol WB protocol for CD11c antibody 60258-1-Ig Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Tissue-resident FOLR2+ macrophages associate with CD8+ T cell infiltration in human breast cancer.
Journal: Cell | Authors: Rodrigo Nalio Ramos | Application: IF - Initiator cell death event induced by SARS-CoV-2 in the human airway epithelium
Journal: Sci Immunol | Authors: Kaixin Liang | Species: human | Application: IF - AIM2 regulates anti-tumor immunity and is a viable therapeutic target for melanoma.
Journal: J Exp Med | Authors: Keitaro Fukuda | Species: human | Application: IF - PMID: 32181805
Journal: J Exp Med | Authors: Xiaoyan Zhan | Species: human | Application: IF - Plasmacytoid and CD141+ Myeloid Dendritic Cells Cooperation with CD8+ T Cells in Lymph Nodes is Associated with HIV Control
Journal: MedComm (2020) | Authors: Joana Vitallé - Loss of IDO1 Expression From Human Pancreatic β-Cells Precedes Their Destruction During the Development of Type 1 Diabetes.
Journal: Diabetes | Authors: Florence Anquetil | Species: human | Application: IF - Pathogen-mimicking Nanoparticles Based on Rigid Nanomaterials as an Efficient Subunit Vaccine Delivery System for Intranasal Iimmunization
Journal: Adv Healthc Mater | Authors: Hongping Wan | Application: IF - Loss of IDO1 Expression From Human Pancreatic β-Cells Precedes Their Destruction During the Development of Type 1 Diabetes.
Journal: Diabetes | Authors: Florence Anquetil | Species: human | Application: IF - Mucoadhesive chitosan-catechol as an efficient vaccine delivery system for intranasal immunization
Journal: Int J Biol Macromol | Authors: Kai Deng | Application: IF - Case Report: Dendritic Cells and Macrophages Capture Sperm in Chronically Inflamed Human Epididymis.
Journal: Front Immunol | Authors: Wenzhong Zheng | Species: human | Application: IF - In Situ Characterization of Human Lymphoid Tissue Immune Cells by Multispectral Confocal Imaging and Quantitative Image Analysis; Implications for HIV Reservoir Characterization.
Journal: Front Immunol | Authors: Eirini Moysi | Application: IF - Inhibition of HMGB1/NF-κB signaling restores Th17/Treg balance via dendritic cell modulation in liver transplant rejection
Journal: Front Immunol | Authors: Linyu Li | Species: rat | Application: IF - In Situ Characterization of Human Lymphoid Tissue Immune Cells by Multispectral Confocal Imaging and Quantitative Image Analysis; Implications for HIV Reservoir Characterization.
Journal: Front Immunol | Authors: Eirini Moysi | Application: IF - EZH2 elicits CD8+ T-cell desert in esophageal squamous cell carcinoma via suppressing CXCL9 and dendritic cells
Journal: Commun Biol | Authors: Chun-Yan Zhu | Species: human | Application: IHC,IF - Allergen-induced dendritic cell autophagy drives immune imbalance in asthma.
Journal: Int Immunopharmacol | Authors: Yuehan Li | Application: IF - Lacrimal Gland Inflammation Deregulates Extracellular Matrix Remodeling and Alters Molecular Signature of Epithelial Stem/Progenitor Cells.
Journal: Invest Ophthalmol Vis Sci | Authors: Takeshi Umazume | Application: WB - The Extracellular Domain of the β2 Integrin β Subunit (CD18) Is Sufficient for Escherichia coli Hemolysin and Aggregatibacter actinomycetemcomitans Leukotoxin Cytotoxic Activity.
Journal: MBio | Authors: Laura C Ristow | Species: human | Application: WB - ITGAX promotes gastric cancer progression via epithelial-mesenchymal transition pathway
Journal: Front Pharmacol | Authors: Jiali Hu | Species: human | Application: WB - Successful treatment with guselkumab of anti-p200 pemphigoid associated with plaque psoriasis
Journal: J Dtsch Dermatol Ges | Authors: Shohei Kitayama | Species: human | Application: IF - Characterising plasmacytoid and myeloid AXL+ SIGLEC-6+ dendritic cell functions and their interactions with HIV
Journal: PLoS Pathog | Authors: Freja A Warner van Dijk | Species: human | Application: IF - High-dimensional Spatial Immune Profiling Highlights Microglia-Like Cells in Human Dorsal Root Ganglia.
Journal: Eur J Immunol | Authors: Marius Schwabenland | Species: human | Application: IHC,IF - Opposing Roles of Sphingosine 1-Phosphate Receptors 1 and 2 in Fat Deposition and Glucose Tolerance in Obese Male Mice
Journal: Endocrinology | Authors: Motochika Asano | Application: IF - Infiltration of TIM4-positive intratumoral macrophages serves as an adverse prognostic factor in breast cancer.
Journal: Breast Cancer | Authors: Mio Yamaguchi-Tanaka | Species: human | Application: IF - Maturity and density of tertiary lymphoid structures associate with tumor metastasis and chemotherapy response
Journal: Front Med (Lausanne) | Authors: Sutian Jiang | Species: human | Application: IHC - [Not Available]
Journal: J Dtsch Dermatol Ges | Authors: Shohei Kitayama | Species: human | Application: IF - Growth differentiation factor-15 promotes immune escape of ovarian cancer via targeting CD44 in dendritic cells.
Journal: Exp Cell Res | Authors: Yunge Gao | Species: human | Application: IHC,IF - Invasion characteristics and clinical significance of tumor-associated macrophages in gastrointestinal Krukenberg tumors
Journal: Front Oncol | Authors: Zigao Huang | Species: human | Application: IHC - Co-loaded simvastatin-ginsenoside Rh2 liposomes enhance cellular immune responses as vaccine adjuvants
Journal: Biochem Biophys Rep | Authors: Yinxiu Huang | Species: human | Application: IF - Food hypersensitivity-induced chronic gastrointestinal inflammation in a non-human primate model of diet-induced obesity.
Journal: PLoS One | Authors: Tomris Mustafa | Species: pig | Application: IHC - Immunohistopathological analyses of a case of pemphigus vegetans with antibodies against desmoglein 1 and desmocollins 1-3
Journal: J Dermatol | Authors: Anri Kimura | Species: human | Application: IF - Tumor β-catenin expression is associated with immune evasion in non-small cell lung cancer with high tumor mutation burden.
Journal: Oncol Lett | Authors: Satoshi Muto | Species: human | Application: IHC - Morphological analysis of cell distribution and network structure via gap junctions in swine corneal stroma
Journal: J Vet Med Sci | Authors: Nobutaka Hoshino | Species: pig | Application: IF - Tumor β-Catenin Expression Associated With Poor Prognosis to Anti-PD-1 Antibody Monotherapy in Non-small Cell Lung Cancer
Journal: Cancer Diagn Progn | Authors: Satoshi Muto | Species: human | Application: IHC
Reviews
Write Your Own Review