Caveolin-1 Monoclonal antibody 66067-1-Ig proteintech
$149.00
In stock
SKU
66067-1-Ig
| Catalog Number | 66067-1-Ig |
| Synonyms | CAV1, Caveolin 1, 6C2B2, BSCL3, CAV |
| Host | Mouse |
| Reactivity | human, mouse, rat, pig and More (4) |
| Reactivity | human, mouse, rat, pig, canine, monkey, chicken, sheep |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IF-P, IP, ELISA |
| Applications | WB, IHC, IF/ICC, IF-P, ELISA |
| Host / Isotype | Mouse / IgG1 |
| Tested Applications — Positive WB detected in | A549 cells, HeLa cells, A431 cells, PC-3 cells, human heart tissue, pig heart tissue, Rat heart tissue, mouse heart tissue |
| Tested Applications — Positive IHC detected in | human ovary tumor tissue, human breast cancer tissue, human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF-P detected in | human liver cancer tissue, mouse kidney tissue, human skin cancer tissue |
| Tested Applications — Positive IF/ICC detected in | A549 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:2000-1:50000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive WB detected in | A549 cells, HeLa cells, A431 cells, PC-3 cells, human heart tissue, pig heart tissue, Rat heart tissue, mouse heart tissue |
| Positive IHC detected in | human ovary tumor tissue, human breast cancer tissue, human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human liver cancer tissue, mouse kidney tissue, human skin cancer tissue |
| Positive IF/ICC detected in | A549 cells |
| Western Blot (WB) | WB : 1:2000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, rat, pig, canine, monkey, chicken, sheep |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag8049 Product name: Recombinant human Caveolin-1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 11-179 aa of BC006432 Sequence: GHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI Predict reactive species |
| Full Name | caveolin 1, caveolae protein, 22kDa |
| Calculated Molecular Weight | 22 kDa |
| Observed Molecular Weight | 20-25 kDa |
| GenBank Accession Number | BC006432 |
| Gene Symbol | CAV1 |
| Gene ID (NCBI) | 857 |
| RRID | AB_11043343 |
| Conjugate | Unconjugated |
| Purification Method | Protein G purification |
| UNIPROT ID | Q03135 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for Caveolin-1 antibody 66067-1-Ig | Download protocol |
| IHC protocol for Caveolin-1 antibody 66067-1-Ig | Download protocol |
| WB protocol for Caveolin-1 antibody 66067-1-Ig | Download protocol |
| human | WB Cells Blocking EREG/GPX4 Sensitizes Head and Neck Cancer to Cetuximab through Ferroptosis Induction Authors - Aude Jehl View Article |
| canine | WB,IP,IF FASEB J Lipid raft interacting galectin 8 regulates primary ciliogenesis Authors - Jhan-Jhang Syu View Article |
| mouse | IF Food Chem Toxicol α-Hemolysin suppresses osteogenesis by inducing lipid rafts accumulation in bone marrow stromal cells. Authors - Guanqiao Liu View Article |
| Citations | 33 |
| Dilutions | WB : 1:2000-1:50000 IHC : 1:2000-1:8000 IF-P : 1:200-1:800 IF/ICC : 1:200-1:800 |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 6C2B2 |
| Conjugation | Unconjugated |
Caveolin-1 (CAV1), a multifunctional protein, is the main constituent molecule of caveolae and represents a scaffolding molecule for several signaling molecules including epidermal growth factor receptor (PMID: 19641024). Several studies have implicated that a reduced expression of CAV1 was found in cancers including head and neck carcinoma (PMID: 19002186). However, other studies recognize CAV1 as a tumor promoter because CAV1 is overexpressed in various kinds of cancers, especially in oral cancer (PMID: 20558341). Recent study also show that CAV1 is involved in gastric Cancer (PMID: 25339030). Protocols Product Specific Protocols IF protocol for Caveolin-1 antibody 66067-1-Ig Download protocol IHC protocol for Caveolin-1 antibody 66067-1-Ig Download protocol WB protocol for Caveolin-1 antibody 66067-1-Ig Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Endothelial discoidin domain receptor 1 senses flow to modulate YAP activation
Journal: Nat Commun | Authors: Jiayu Liu | Species: human | Application: IF - Inhibition of EGFR Overcomes Acquired Lenvatinib Resistance Driven by STAT3-ABCB1 Signaling in Hepatocellular Carcinoma
Journal: Cancer Res | Authors: Beiyuan Hu | Species: human | Application: IF - CLSTN3 gene variant associates with obesity risk and contributes to dysfunction in white adipose tissue.
Journal: Mol Metab | Authors: Ningning Bai | Species: human | Application: WB - Blocking EREG/GPX4 Sensitizes Head and Neck Cancer to Cetuximab through Ferroptosis Induction
Journal: Cells | Authors: Aude Jehl | Species: human | Application: WB - Lipid raft interacting galectin 8 regulates primary ciliogenesis
Journal: FASEB J | Authors: Jhan-Jhang Syu | Species: canine | Application: WB,IP,IF - α-Hemolysin suppresses osteogenesis by inducing lipid rafts accumulation in bone marrow stromal cells.
Journal: Food Chem Toxicol | Authors: Guanqiao Liu | Species: mouse | Application: IF - Huang-Lian-Jie-Du decoction inhibits CD4+ T cell infiltration into CNS in MCAO rats by regulating BBB
Journal: Phytomedicine | Authors: Congai Chen | Species: rat | Application: WB,IF - Ultrasound-Guided Functionalized Extracellular Vesicles for Visualized, Controlled, and Efficient Renal Delivery for Enhanced Kidney Repair
Journal: Adv Healthc Mater | Authors: Yuhao Chen | Species: human | Application: WB - Integrative insights into the role of CAV1 in ketogenic diet and ferroptosis in pancreatic cancer
Journal: Cell Death Discov | Authors: Xue Liang | Species: human | Application: WB,IP,IF - Autophagy Reduces the Degradation and Promotes Membrane Localization of Occludin to Enhance the Intestinal Epithelial Tight Junction Barrier against Paracellular Macromolecule Flux
Journal: J Crohns Colitis | Authors: Kushal Saha | Species: mouse | Application: WB - HCN2 deficiency correlates with memory deficits and hyperexcitability of dCA1 pyramidal neurons in Alzheimer's disease
Journal: Alzheimers Res Ther | Authors: Xiaoqin Zhang | Species: mouse | Application: WB - Inflammatory Cell-Derived MYDGF Attenuates Endothelial LDL Transcytosis to Protect Against Atherogenesis
Journal: Arterioscler Thromb Vasc Biol | Authors: Jinling Xu - Perturbation of intestinal stem cell homeostasis and radiation enteritis recovery via dietary titanium dioxide nanoparticles
Journal: Cell Prolif | Authors: Linpei Zhang | Species: mouse | Application: IF - Syringaresinol alleviates acetaminophen-induced hepatocyte ferroptosis through the Nrf2/HO-1 pathway by targeting Caveolin-1.
Journal: Chin Med | Authors: Lei Cao | Species: mouse | Application: WB,IHC - Steatotic hepatocyte-derived exosomes increase free fatty acids uptake by transporting miR-122-5p to target ATP6V1H-mediated CD36 translocation in hepatocytes.
Journal: Clin Sci (Lond) | Authors: Junbin Chen - Effects of apolipoprotein E on regulating insulin sensitivity via regulating insulin receptor signalosome in caveolae
Journal: Life Sci | Authors: Miao Liu | Species: mouse,human | Application: WB,IP,IF - CLSTN3 gene variant associates with obesity risk and contributes to dysfunction in white adipose tissue.
Journal: Mol Metab | Authors: Ningning Bai | Species: human | Application: WB - Blocking EREG/GPX4 Sensitizes Head and Neck Cancer to Cetuximab through Ferroptosis Induction
Journal: Cells | Authors: Aude Jehl | Species: human | Application: WB - Tenascin‑C promotes epidural fibrosis via regulating caveolin-1-mediated TGFβRI internalization.
Journal: Matrix Biol | Authors: Zeyuan Song | Species: mouse | Application: WB,IP,IF - Targeting NLRC5 in cardiomyocytes protects postinfarction cardiac injury by enhancing autophagy flux through the CAVIN1/CAV1 axis
Journal: Commun Biol | Authors: Lingfeng Gu | Species: mouse | Application: WB - Polyphyllin H Reverses Paclitaxel Resistance in Breast Cancer by Binding Membrane Cholesterol to Inhibit Both ABCB1 and ABCC3.
Journal: Pharmaceuticals (Basel) | Authors: Zheng Ye | Species: human | Application: WB,IF - Lipid raft interacting galectin 8 regulates primary ciliogenesis
Journal: FASEB J | Authors: Jhan-Jhang Syu | Species: canine | Application: WB,IP,IF - A high cholesterol diet aggravates experimental colitis through SREBP2-modulated endocytosis and degradation of occludin and Zo-1 proteins
Journal: FEBS J | Authors: Qin Yang | Species: human | Application: WB,IF - Motile hepatocellular carcinoma cells preferentially secret sugar metabolism regulatory proteins via exosomes.
Journal: Proteomics | Authors: Jing Zhang | Species: human | Application: WB - α-Hemolysin suppresses osteogenesis by inducing lipid rafts accumulation in bone marrow stromal cells.
Journal: Food Chem Toxicol | Authors: Guanqiao Liu | Species: mouse | Application: IF - Caveolin 1 Regulates the Tight Junctions between Sertoli Cells and Promotes the Integrity of Blood-Testis Barrier in Yak via the FAK/ERK Signaling Pathway
Journal: Animals (Basel) | Authors: Qiu Yan | Species: human | Application: WB - Mycoplasma synoviae elongation factor thermo stable is an adhesion-associated protein that enters cells by endocytosis and stimulates DF-1 cell proliferation
Journal: BMC Vet Res | Authors: Yunhai Zhao | Species: chicken | Application: IF - Glaesserella parasuis serotype 5 promotes pyroptosis via degrading Caveolin-1 in 3D4/21 cells
Journal: Vet Microbiol | Authors: Huixing Lin | Species: pig | Application: WB - Swine interferon-induced transmembrane proteins inhibit porcine epidemic diarrhea virus replication
Journal: Vet Microbiol | Authors: Qian Zhang | Species: monkey | Application: IF - Annexin A2 orchestrates CSFV entry route selection via the annexin A2/S100A10 heterotetrameric complex.
Journal: Vet Microbiol | Authors: Xingwen Bai | Species: pig | Application: IF - Inhibition of enhanced green fluorescent protein cytosolic delivery mediated by modified cell-penetrating peptide due to high overexpression of Caveolin-1
Journal: Biochem Biophys Res Commun | Authors: Akiko Okuda | Species: human | Application: WB,IHC - Regulatory role of melatonin on epidermal growth factor receptor, Type I collagen α1 chain, and caveolin 1 in granulosa cells of sheep antral follicles
Journal: Anim Sci J | Authors: Wenjuan Wang | Species: sheep | Application: WB,IHC - MicroRNA-451a targets caveolin-1 in stomach cancer cells.
Journal: Int J Clin Exp Pathol | Authors: Yi Wang | Species: human | Application: WB - Galectin-1 Modulates Cell Adhesions, Cavin-1 phosphorylation, and Vascular Permeability in Kidney Endothelial Cells - Insights from Proteomics, Phosphoproteomics, and Functional Studies.
Journal: Mol Cell Proteomics | Authors: Alex Boshart
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
