CEACAM7 Polyclonal antibody 24626-1-AP proteintech
$149.00
In stock
SKU
24626-1-AP
| Catalog Number | 24626-1-AP |
| Synonyms | Carcinoembryonic antigen CGM2, CEA, CEACAM7, CGM2 |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse colon tissue |
| Tested Applications — Positive IHC detected in | human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:200-1:1000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Positive WB detected in | mouse colon tissue |
| Positive IHC detected in | human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Tested Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag18579 Product name: Recombinant human CEACAM7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 113-213 aa of BC121132 Sequence: VTHNDAGIYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGP Predict reactive species |
| Full Name | carcinoembryonic antigen-related cell adhesion molecule 7 |
| Calculated Molecular Weight | 265 aa, 29 kDa |
| Observed Molecular Weight | 58 kDa |
| GenBank Accession Number | BC121132 |
| Gene Symbol | CEACAM7 |
| Gene ID (NCBI) | 1087 |
| RRID | AB_3085742 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q14002 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for CEACAM7 antibody 24626-1-AP | Download protocol |
| WB protocol for CEACAM7 antibody 24626-1-AP | Download protocol |
| Citations | - |
| Dilutions | WB : 1:200-1:1000 IHC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
CEACAM7, also known as CGM2, belongs to the carcinoembryonic antigen (CEA) family. CEACAM7 contains three domains: an N-terminal IgV domain, a single IgC2 domain, and a cell-surface GPI anchor domain. CEACAM7 achieves cell adhesion through dimerization of the N-terminal IgV domain. CEACAM7 is expressed on highly differentiated epithelial cells of the colon and rectum and on the epithelial cells within the ducts of the pancreas (PMID: 26323304). CEACAM7 has 2 isoforms with the molecular mass of 19 and 29 kDa. The observed MW of CEACAM7 is 58 kDa, which is consistent with the description in the literature (PMID: 36828119). Protocols Product Specific Protocols IHC protocol for CEACAM7 antibody 24626-1-AP Download protocol WB protocol for CEACAM7 antibody 24626-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
