CDX2 Monoclonal antibody 60243-1-Ig proteintech
$149.00
In stock
SKU
60243-1-Ig
| Catalog Number | 60243-1-Ig |
| Synonyms | 5A4E6, Caudal type homeobox 2, Caudal type homeobox protein 2, Caudal-type homeobox protein 2, CDX 3 |
| Host | Mouse |
| Reactivity | human, pig and More (1) |
| Reactivity | human, pig, bovine |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, ELISA |
| Applications | WB, IF/ICC, ELISA |
| Host / Isotype | Mouse / IgG1 |
| Tested Applications — Positive WB detected in | COLO 320 cells, HT-29 cells, SW 1990 cells, pig colon tissue |
| Tested Applications — Positive IF/ICC detected in | Caco-2 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:6000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Positive WB detected in | COLO 320 cells, HT-29 cells, SW 1990 cells, pig colon tissue |
| Positive IF/ICC detected in | Caco-2 cells |
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Tested Reactivity | human, pig |
| Cited Reactivity | human, bovine |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag17644 Product name: Recombinant human CDX2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-180 aa of BC014461 Sequence: MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQ Predict reactive species |
| Full Name | caudal type homeobox 2 |
| Calculated Molecular Weight | 313 aa, 34 kDa |
| Observed Molecular Weight | 33-40 kDa |
| GenBank Accession Number | BC014461 |
| Gene Symbol | CDX2 |
| Gene ID (NCBI) | 1045 |
| RRID | AB_2881365 |
| Conjugate | Unconjugated |
| Purification Method | Protein G purification |
| UNIPROT ID | Q99626 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for CDX2 antibody 60243-1-Ig | Download protocol |
| WB protocol for CDX2 antibody 60243-1-Ig | Download protocol |
| human | WB Chem Biol Interact 6-Formylindolo(3,2-b)carbazole induced aryl hydrocarbon receptor activation prevents intestinal barrier dysfunction through regulation of claudin-2 expression. Authors - Yuanhang Ma KD Validated View Article |
| A (Verified Customer) (07-15-2025) | Used for caco2 cells and animal colon tissue Applications: Western Blot, Immunohistochemistry Primary Antibody Dilution: 1 to 1000 |
| Citations | 27 |
| Dilutions | WB : 1:1000-1:6000 IF/ICC : 1:400-1:1600 |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 5A4E6 |
| Conjugation | Unconjugated |
CDX2, also named as Homeobox protein CDX-2, is a 313 amino acid protein, which contains one homeobox DNA-binding domain and belongs to the Caudal homeobox family. CDX2 localizes in the nucleus and is involved in the transcriptional regulation of multiple genes expression in the intestinal epithelium. The relative expression of CDX1 to CDX2 protein may be important in the anterior to posterior patterning of the intestinal epithelium and in defining patterns of proliferation and differentiation along the crypt-villus axis. Both Cdx1 and Cdx2 genes must be expressed to reduce tumorigenic potential, to increase sensitivity to apoptosis, and to reduce cell migration, suggesting that the two genes control the normal phenotype by independent pathways. Protocols Product Specific Protocols IF protocol for CDX2 antibody 60243-1-Ig Download protocol WB protocol for CDX2 antibody 60243-1-Ig Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- FOLR2+ macrophage depletion from intestinal metaplasia to early gastric cancer: single-cell sequencing insight into gastric cancer progression
Journal: J Exp Clin Cancer Res | Authors: Yuxin He | Species: human | Application: WB - The role of CDX2 in renal tubular lesions during diabetic kidney disease.
Journal: Aging (Albany NY) | Authors: Huiming Liu KD Validated | Application: WB - Vitronectin Destroyed Intestinal Epithelial Cell Differentiation through Activation of PDE4-Mediated Ferroptosis in Inflammatory Bowel Disease
Journal: Mediators Inflamm | Authors: Wenxu Pan | Species: human | Application: WB,IF - Poly(I:C) exposure during in vitro fertilization disrupts first cleavage of mouse embryos and subsequent blastocyst development.
Journal: J Reprod Immunol | Authors: Zhicheng Wang | Application: IF - 6-Formylindolo(3,2-b)carbazole induced aryl hydrocarbon receptor activation prevents intestinal barrier dysfunction through regulation of claudin-2 expression.
Journal: Chem Biol Interact | Authors: Yuanhang Ma KD Validated | Species: human | Application: WB - Xiaojianzhong decoction prevents gastric precancerous lesions in rats by inhibiting autophagy and glycolysis in gastric mucosal cells
Journal: World J Gastrointest Oncol | Authors: Jia-Xiang Zhang | Application: IHC - Yiqi Huayu Jiedu formula inhibits JAK2/STAT3-mediated partial EMT in treating chronic atrophic gastritis
Journal: Phytomedicine | Authors: Weifeng Yu | Species: human | Application: WB - Alpha lipoamide inhibits diabetic kidney fibrosis via improving mitochondrial function and regulating RXRα expression and activation
Journal: Acta Pharmacol Sin | Authors: Hui-Fang Zhang | Application: WB - Engineered tumor microspheres via microfluidics and decellularized extracellular matrix for high-throughput organoid-based drug screening
Journal: Biofabrication | Authors: Jinlong Jin | Application: IF - The Ameliorative Effects of Carnosine on the In Vitro Developmental Competence of Bovine Oocytes.
Journal: Antioxidants (Basel) | Authors: Xuan Leng | Species: bovine | Application: IF - Combining single-cell profiling and functional analysis explores the role of pseudogenes in human early embryonic development
Journal: J Genet Genomics | Authors: Mengyao Sun | Species: human | Application: IF - Alpha-tocopherylquinone differentially modulates claudins to enhance intestinal epithelial tight junction barrier via AhR and Nrf2 pathways
Journal: Cell Rep | Authors: Ashwinkumar Subramenium Ganapathy | Species: human - The role of CDX2 in renal tubular lesions during diabetic kidney disease.
Journal: Aging (Albany NY) | Authors: Huiming Liu | Application: WB - Rabeprazole suppressed gastric intestinal metaplasia through activation of GPX4-mediated ferroptosis
Journal: Front Pharmacol | Authors: Jing Xie | Species: human | Application: WB,IHC - 6-Formylindolo(3,2-b)carbazole induced aryl hydrocarbon receptor activation prevents intestinal barrier dysfunction through regulation of claudin-2 expression.
Journal: Chem Biol Interact | Authors: Yuanhang Ma | Species: human | Application: WB - Nuclear transcription factor CDX2 inhibits gastric cancer‑cell growth and reverses epithelial‑to‑mesenchymal transition in vitro and in vivo.
Journal: Mol Med Rep | Authors: Jian-Feng Zhang - Vitronectin Destroyed Intestinal Epithelial Cell Differentiation through Activation of PDE4-Mediated Ferroptosis in Inflammatory Bowel Disease
Journal: Mediators Inflamm | Authors: Wenxu Pan | Species: human | Application: WB,IF - Dissecting the role of the endoplasmic reticulum in trophectoderm development and blastocyst quality in yak.
Journal: J Dairy Sci | Authors: Lili Li - Effect of microgravity on mammalian embryo development evaluated at the International Space Station
Journal: iScience | Authors: Sayaka Wakayama | Application: IF - P53 Deficiency Accelerate Esophageal Epithelium Intestinal Metaplasia Malignancy
Journal: Biomedicines | Authors: Quanpeng Qiu | Species: human | Application: WB - Poly(I:C) exposure during in vitro fertilization disrupts first cleavage of mouse embryos and subsequent blastocyst development.
Journal: J Reprod Immunol | Authors: Zhicheng Wang | Application: IF - Shikonin improves intestinal barrier function through modulation of GPX4 expression in intestinal epithelial cells.
Journal: Int J Immunopathol Pharmacol | Authors: Fuheng Yang | Species: human | Application: WB,IF - Xiaojianzhong decoction prevents gastric precancerous lesions in rats by inhibiting autophagy and glycolysis in gastric mucosal cells
Journal: World J Gastrointest Oncol | Authors: Jia-Xiang Zhang | Application: IHC - Ratio of the zygote cytoplasm to the paternal genome affects the reprogramming and developmental efficiency of androgenetic embryos.
Journal: Mol Reprod Dev | Authors: Chen Liao | Application: IF - KPNA2 knockdown suppresses gastric cancer progression through modulation of the β-catenin/EMT signaling axis, inducing cell cycle arrest, apoptosis, and reduced metastatic capacity.
Journal: J Mol Histol | Authors: Haoyu Zhu - Budget-Friendly Generation, Biochemical Analyses, and Lentiviral Transduction of Patient-Derived Colon Organoids
Journal: Curr Protoc | Authors: Emilie Rigaux | Application: IF - Comparison of clinical manifestations and immunoreactivities of Meckel's diverticulum with and without gastric heteroplasia
Journal: Front Pediatr | Authors: Ting Ting Zhang | Species: human | Application: IHC
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
