CoraLite® Plus 488-conjugated CISD2 Recombinant monoclonal antibody CL488-82802-10 proteintech
$479.00
In stock
SKU
CL488-82802-10
| Catalog Number | CL488-82802-10 |
| Synonyms | 6H13, CDGSH iron sulfur domain 2, CDGSH iron-sulfur domain-containing protein 2, CDGSH2, ERIS |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Proclin300, BSA, Glycerol |
| Applications | IF/ICC |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive IF/ICC detected in | HepG2 cells |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive IF/ICC detected in | HepG2 cells |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | human, mouse |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag4172 Product name: Recombinant human CISD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 61-135 aa of BC032300 Sequence: PKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV Predict reactive species |
| Full Name | CDGSH iron sulfur domain 2 |
| Calculated Molecular Weight | 135 aa, 15 kDa |
| Observed Molecular Weight | 15 kDa |
| GenBank Accession Number | BC032300 |
| Gene Symbol | CISD2 |
| Gene ID (NCBI) | 493856 |
| RRID | AB_3673082 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Purification Method | Protein A purification |
| UNIPROT ID | Q8N5K1 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. |
| IF protocol for CL Plus 488 CISD2 antibody CL488-82802-10 | Download protocol |
| Citations | - |
| Dilutions | IF/ICC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 6H13 |
| Conjugation | CoraLite® Plus 488 |
CISD2 gene encodes a 15 kDa CDGSH iron-sulfur domain-containing protein 2, which is also named Miner1 or NAF-1, this protein was reported on endoplasmic reticulum membrane or mitochondrion outer membrane. Defects in CISD2 are the cause of Wolfram syndrome type 2 (WFS2), a rare disorder characterized by juvenile-onset insulin-dependent diabetes mellitus with optic atrophy. CISD2 regulates autophagy program by interacting BCL2, contributing to antagonize BECN1-mediated cellular autophagy at the endoplasmic reticulum. Protocols Product Specific Protocols IF protocol for CL Plus 488 CISD2 antibody CL488-82802-10 Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
