EPCAM/CD326 Monoclonal antibody 66316-1-Ig proteintech
$149.00
In stock
SKU
66316-1-Ig
| Catalog Number | 66316-1-Ig |
| Synonyms | EPCAM, 2A2D5, Adenocarcinoma-associated antigen, CD326, Cell surface glycoprotein Trop-1 |
| Host | Mouse |
| Reactivity | human and More (1) |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IF-P, ELISA |
| Host / Isotype | Mouse / IgG2a |
| Tested Applications — Positive WB detected in | HaCaT cells, A431 cells, T-47D cells, MCF-7 cells |
| Tested Applications — Positive IHC detected in | Human colon tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF-P detected in | human colon cancer tissue, human stomach cancer tissue |
| Tested Applications — Positive IF/ICC detected in | MCF-7 cells, HT-29 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:2000-1:10000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive WB detected in | HaCaT cells, A431 cells, T-47D cells, MCF-7 cells |
| Positive IHC detected in | Human colon tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human colon cancer tissue, human stomach cancer tissue |
| Positive IF/ICC detected in | MCF-7 cells, HT-29 cells |
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag15393 Product name: Recombinant human EPCAM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-264 aa of BC014785 Sequence: QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGL Predict reactive species |
| Full Name | epithelial cell adhesion molecule |
| Calculated Molecular Weight | 314 aa, 35 kDa |
| Observed Molecular Weight | 35-40 kDa |
| GenBank Accession Number | BC014785 |
| Gene Symbol | EPCAM |
| Gene ID (NCBI) | 4072 |
| RRID | AB_2881697 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P16422 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for EPCAM/CD326 antibody 66316-1-Ig | Download protocol |
| IHC protocol for EPCAM/CD326 antibody 66316-1-Ig | Download protocol |
| WB protocol for EPCAM/CD326 antibody 66316-1-Ig | Download protocol |
| human | WB Cell Death Dis Mutations in the coat complex II component SEC23B promote colorectal cancer metastasis. Authors - Chunyuan Yang View Article |
| Guorong (Verified Customer) (03-31-2022) | Seems not good for ARPE-19 cells Applications: Western Blot Primary Antibody Dilution: 1:2000 Cell Tissue Type: ARPE-19 EPCAM/CD326 Antibody Western Blot validation (1:2000 dilution) in ARPE-19 (Cat no:66316-1-Ig) |
| Citations | 21 |
| Dilutions | WB : 1:2000-1:10000 IHC : 1:1000-1:4000 IF-P : 1:200-1:800 IF/ICC : 1:200-1:800 |
| Isotype | IgG2a |
| Clonality | Monoclonal |
| Clone Number | 2A2D5 |
| Conjugation | Unconjugated |
Epithelial cell adhesion molecule (EpCAM, CD326) is a type I transmembrane glycoprotein that functions as a homophilic, epithelial-specific intercellular cell-adhesion molecule. In addition to cell adhesion, EpCAM is also involved in cellular signaling, cell migration, proliferation, and differentiation. EpCAM is highly expressed on most carcinomas and therefore of potential use as a diagnostic and prognostic marker for a variety of carcinomas, and has become a therapeutic target. EpCAM may occur in distinct forms due to glycosylation. (PMID: 20837599; 19249674; 21576002; 22647938; 12691820) Protocols Product Specific Protocols IF protocol for EPCAM/CD326 antibody 66316-1-Ig Download protocol IHC protocol for EPCAM/CD326 antibody 66316-1-Ig Download protocol WB protocol for EPCAM/CD326 antibody 66316-1-Ig Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Tumor cell membrane-based peptide delivery system targeting the tumor microenvironment for cancer immunotherapy and diagnosis.
Journal: Acta Biomater | Authors: Xiangzhou Meng | Species: human | Application: WB - Spherical nucleic acids-based cascade signal amplification for highly sensitive detection of exosomes.
Journal: Biosens Bioelectron | Authors: Lei Wang | Species: human - miR-552 Regulates Liver Tumor-Initiating Cell Expansion and Sorafenib Resistance.
Journal: Mol Ther Nucleic Acids | Authors: Tao Han | Species: human | Application: WB - Multi-modal imaging probe for EpCAM overexpressed in breast cancer.
Journal: Talanta | Authors: Yaxue Dai KD Validated | Species: human | Application: WB - Mutations in the coat complex II component SEC23B promote colorectal cancer metastasis.
Journal: Cell Death Dis | Authors: Chunyuan Yang | Species: human | Application: WB - MCM2 promotes the stemness and sorafenib resistance of hepatocellular carcinoma cells via hippo signaling
Journal: Cell Death Discov | Authors: Xin Zhou | Application: WB - Tumor cell membrane-based peptide delivery system targeting the tumor microenvironment for cancer immunotherapy and diagnosis.
Journal: Acta Biomater | Authors: Xiangzhou Meng | Species: human | Application: WB - MCM2 promotes the stemness and sorafenib resistance of hepatocellular carcinoma cells via hippo signaling
Journal: Cell Death Discov | Authors: Xin Zhou | Application: WB - NDRG1 facilitates self-renewal of liver cancer stem cells by preventing EpCAM ubiquitination
Journal: Br J Cancer | Authors: Qian Cheng - SERPINA3 mediates liver cancer cells escape from chemotherapy-induced neutrophil extracellular trap killing.
Journal: Cell Rep | Authors: Yuan Zhang - Multi-modal imaging probe for EpCAM overexpressed in breast cancer.
Journal: Talanta | Authors: Yaxue Dai | Species: human | Application: WB - miR-552 Regulates Liver Tumor-Initiating Cell Expansion and Sorafenib Resistance.
Journal: Mol Ther Nucleic Acids | Authors: Tao Han | Species: human | Application: WB - Photo-functionalized TiO2 film for facile immobilization of EpCAM antibodies and efficient enrichment of circulating tumor cells
Journal: Front Pharmacol | Authors: Huan Deng - Alpha-fetoprotein acts as a key regulator of cancer stemness in hepatocellular carcinoma via PI3K/Akt pathway.
Journal: Cell Signal | Authors: Gulijiamali Kahaer - Uncovering cantharidin's mechanism for cholangiocarcinoma treatment using patient-derived tumor organoids.
Journal: iScience | Authors: Pinsheng Han | Species: human | Application: IHC,IF - Modeling hepatic steatosis with human adult stem cell-derived liver organoids
Journal: iScience | Authors: Liuyang Zhu | Species: human | Application: IF - Individualized drug screening in cholangiocarcinoma using organoid models and patient-derived tumor xenograft.
Journal: BMC Cancer | Authors: Pinsheng Han | Species: human | Application: IHC,IF - Downregulation of NEBL promotes migration and invasion of clear cell renal cell carcinoma by inducing epithelial-mesenchymal transition
Journal: Pathol Res Pract | Authors: Ran Zhao | Species: human | Application: WB - Deciphering the cellular landscape and potential targets of nasopharyngeal and oral cancers using single-cell RNA sequencing
Journal: Cell Biol Int | Authors: Yanfei Zhang | Species: mouse | Application: IF - Immunohistochemistry identifies E-cadherin, N-cadherin and focal adhesion kinase (FAK) as predictors of stage I non-small cell lung carcinoma spread through the air spaces (STAS), and the combinations as prognostic factors
Journal: Transl Lung Cancer Res | Authors: Yunchang Meng | Species: human | Application: IHC - Insights into the role of MSLN-positive circulating tumor cell as an auxiliary diagnostic biomarker in epithelial ovarian cancer
Journal: Front Oncol | Authors: Hang Xu
Reviews
Write Your Own Review