Jagged1/CD339 Monoclonal antibody 66890-1-Ig proteintech
$149.00
In stock
SKU
66890-1-Ig
| Catalog Number | 66890-1-Ig |
| Synonyms | JAG1, Jagged1, 2A7D11, CD339, HJ1 |
| Host | Mouse |
| Reactivity | human and More (3) |
| Reactivity | human, mouse, rat, goat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, ELISA |
| Applications | WB, ELISA |
| Host / Isotype | Mouse / IgA |
| Tested Applications — Positive WB detected in | HEK-293 cells, HT-29 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Positive WB detected in | HEK-293 cells, HT-29 cells |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat, goat |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag11891 Product name: Recombinant human Jagged1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 35-350 aa of BC098393 Sequence: FELEILSMQNVNGELQNGNCCGGARNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFEYQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIAEHACLSDPCHNRGS Predict reactive species |
| Full Name | jagged 1 (Alagille syndrome) |
| Calculated Molecular Weight | 1218 aa, 134 kDa |
| Observed Molecular Weight | 150 kDa |
| GenBank Accession Number | BC098393 |
| Gene Symbol | Jagged1 |
| Gene ID (NCBI) | 182 |
| RRID | AB_2882220 |
| Conjugate | Unconjugated |
| Purification Method | Thiophilic affinity chromatograph |
| UNIPROT ID | P78504 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for Jagged1/CD339 antibody 66890-1-Ig | Download protocol |
| human | WB Acta Histochem miR-214-5p suppresses the proliferation, migration and invasion of trophoblast cells in pre-eclampsia by targeting jagged 1 to inhibit notch signaling pathway. Authors - Fengyan Gong View Article |
| Citations | 23 |
| Dilutions | WB : 1:5000-1:50000 |
| Isotype | IgA |
| Clonality | Monoclonal |
| Clone Number | 2A7D11 |
| Conjugation | Unconjugated |
Jagged1 is a type I, membrane- anchored, multidomain protein and a ligand of the Notch receptor. The receptor-ligand interaction can trigger the Notch signaling and activate transcription factors that play key roles in cell differentiation and morphogenesis. The predicted MW of Jagged1 is 134 kDa, while higher MW around 150-180 kDa had been observed in literations (PMID: 9716576, 9596653). Protocols Product Specific Protocols WB protocol for Jagged1/CD339 antibody 66890-1-Ig Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Ryanodine receptor 2 promotes colorectal cancer metastasis by the ROS/BACH1 axis
Journal: Mol Oncol | Authors: Tianwei Chen | Species: human | Application: WB - Linc-KILH potentiates Notch1 signaling through inhibiting KRT19 phosphorylation and promotes the malignancy of hepatocellular carcinoma.
Journal: Int J Biol Sci | Authors: Xudong Zhang | Species: human | Application: WB - Generation and characterization of cardiac valve endothelial-like cells from human pluripotent stem cells.
Journal: Commun Biol | Authors: LinXi Cheng | Species: human - IL-7-Treated Periodontal Ligament Cells Regulate Local Immune Homeostasis by Modulating Treg/Th17 Cell Polarization.
Journal: Front Med (Lausanne) | Authors: Xin-Yi Yu | Species: human | Application: WB - LncRNA TDRG1/miR-214-5p axis affects preeclampsia by modulating trophoblast cells.
Journal: Cell Biochem Funct | Authors: Fengyan Gong | Species: human | Application: WB - miR-214-5p suppresses the proliferation, migration and invasion of trophoblast cells in pre-eclampsia by targeting jagged 1 to inhibit notch signaling pathway.
Journal: Acta Histochem | Authors: Fengyan Gong | Species: human | Application: WB - Significance of NotchScore and JAG1 in predicting prognosis and immune response of low-grade glioma
Journal: Front Immunol | Authors: Bo Shi | Species: human | Application: WB - The role of estrogen receptors (ERs)-Notch pathway in thyroid toxicity induced by Di-2-ethylhexyl phthalate (DEHP) exposure: Population data and in vitro studies
Journal: Ecotoxicol Environ Saf | Authors: Xueting Zhang | Species: human | Application: WB - Lp-PLA2-derived LysoPC drives dendritic cell immunogenic activation and Th17 inflammation in severe asthma.
Journal: Inflamm Res | Authors: Fang Wang | Species: mouse | Application: WB - Generation and characterization of cardiac valve endothelial-like cells from human pluripotent stem cells.
Journal: Commun Biol | Authors: LinXi Cheng | Species: human - Inhibition of liver cancer cell growth by metabolites S-adenosylmethionine and nicotinic acid originating from liver progenitor cells
Journal: J Gastroenterol | Authors: Wen-Ming Liu | Species: human | Application: WB,IHC,IF - DOT1L promotes phenotypic transition of vascular smooth muscle cells following vascular injury in diabetes through activation of the FGFR4/PI3K/AKT/Jag/Notch signaling pathway.
Journal: Cell Signal | Authors: Jing Zhang | Species: rat | Application: WB,IHC,IF - Ryanodine receptor 2 promotes colorectal cancer metastasis by the ROS/BACH1 axis
Journal: Mol Oncol | Authors: Tianwei Chen | Species: human | Application: WB - Comprehensive multiomic analysis of extracellular vesicles from Mycoplasma bovis-infected bovine mammary epithelial cells identifies proteins and miRNAs that induce inflammatory responses in macrophages
Journal: Vet Res | Authors: Yiming Wu | Application: WB - IL-7-Treated Periodontal Ligament Cells Regulate Local Immune Homeostasis by Modulating Treg/Th17 Cell Polarization.
Journal: Front Med (Lausanne) | Authors: Xin-Yi Yu | Species: human | Application: WB - LncRNA TDRG1/miR-214-5p axis affects preeclampsia by modulating trophoblast cells.
Journal: Cell Biochem Funct | Authors: Fengyan Gong | Species: human | Application: WB - A comprehensive role evaluation and mechanism exploration of POGLUT2 in pan-cancer
Journal: Front Oncol | Authors: Xianyun Xu | Species: human | Application: WB - Altered Notch pathway-related protein expression in cord blood of preeclampsia offspring: a pilot study.
Journal: BMC Pregnancy Childbirth | Authors: Ouxuan Jin | Species: human | Application: WB - A cardiac-related, promoter-proximal, regulatory element shapes chromatin and JAG1 transcription.
Journal: Life Sci Alliance | Authors: Quannan Zhuang | Species: human | Application: WB - miR-214-5p suppresses the proliferation, migration and invasion of trophoblast cells in pre-eclampsia by targeting jagged 1 to inhibit notch signaling pathway.
Journal: Acta Histochem | Authors: Fengyan Gong | Species: human | Application: WB - Notch signaling pathway regulates the progression of fetal growth restriction through mediating immune dysfunction
Journal: Biomed Rep | Authors: Liyan Ye - STK214947, a novel indole alkaloids, inhibits HeLa and SK-HEP-1 cells survival and EMT process by blocking the Notch3 and Akt signals
Journal: Anticancer Drugs | Authors: Zihan Xu | Species: human | Application: WB - Effects of Tricholoma matsutake (Agaricomycetes) Extracts on Promoting Proliferation of HaCaT Cells and Accelerating Mice Wound Healing
Journal: Int J Med Mushrooms | Authors: Wenyu Zhu | Species: human | Application: WB - Nucleolar METTL16 drives ccRCC tumorigenesis and pazopanib resistance via translational activation of JAG1/Notch signaling pathway.
Journal: Drug Resist Updat | Authors: Zixuan Gong | Species: human | Application: IHC
Product Documents
Reviews
Write Your Own Review