CLEC2L Recombinant monoclonal antibody, PBS Only 87144-1-PBS proteintech
$699.00
In stock
SKU
87144-1-PBS
| Catalog Number | 87144-1-PBS |
| Synonyms | C-type lectin domain family 2 member L, C-Type Lectin Domain Family 2, Member L |
| Host | Rabbit |
| Reactivity | human, mouse, rat, pig |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | WB, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human, mouse, rat, pig |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag35450 Product name: Recombinant human CLEC2L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 90-214 aa of NM_001080511.2 Sequence: SKGCIKCEAPCPEDWLLYGRKCYFFSEEPRDWNTGRQYCHTHEAVLAVIQSQKELEFMFKFTRREPWIGLRRVGDEFHWVNGDPFDPDTFTIAGPGECVFVEPTRLVSTECLMTRPWVCSKMAYT Predict reactive species |
| Full Name | C-type lectin domain family 2, member L |
| Calculated Molecular Weight | 24 kDa |
| Observed Molecular Weight | 24 kDa |
| GenBank Accession Number | NM_001080511.2 |
| Gene Symbol | CLEC2L |
| Gene ID (NCBI) | 154790 |
| RRID | AB_3745367 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P0C7M8 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 252317D2 |
| Conjugation | Unconjugated |
C-type lectin domain family 2 member L (CLEC2L) is a membrane protein mainly expressed in brain tissue and probably has carbohydrate-binding activity. The CLEC2L-encoded C-type lectin-like receptors (CTLRs) are expressed as non-glycosylated, disulfide-linked homodimers at the cell surface, and designated as BACL (brain-associated C-type lectin) (PMID: 23776472). The CLEC2L protein has 214 amino acids with a predicted molecular mass of 23.9 kDa. Under non-reducing conditions, FLAG-tagged CLEC2L proteins appeared with a molecular mass of ~55 kDa in immunoblots because of the occurrence of disulfide-linked homodimers (PMID: 23776472).
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
